KEGG   Streptomyces pratensis: Sfla_4111
Entry
Sfla_4111         CDS       T01647                                 

Definition
(GenBank) pyruvate carboxyltransferase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00072  Synthesis and degradation of ketone bodies
sfa00280  Valine, leucine and isoleucine degradation
sfa00281  Geraniol degradation
sfa00650  Butanoate metabolism
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Sfla_4111
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Sfla_4111
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sfla_4111
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Sfla_4111
Enzymes [BR:sfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     Sfla_4111
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-ProteinID: ADW05522
UniProt: E8W8W4
Position
complement(4740692..4741642)
AA seq 316 aa
MTDTGLPMTVPAQGLPDRVRIHEVGARDGLQNEKSVVPTEVKAEFVRRLAEAGLSTIEAT
SFVHPKWVPQLADAEQLFPMLGEIADVGDVALPVLVPNERGLDRALALGARRIAVFGSAT
ETFAARNLNRTVDGSLAMFEPVVARAKDAGVHVRGYLSMCFGDPWEGAVPVPQVVRVAKA
LMDLGCDELSLGDTIGVATPGHVRELLSGLNDAGVATGTVGVHFHDTYGQALSNTLAALQ
HGVTTVDASAGGLGGCPYAKSATGNLATEDLVWMLDGLGVHTGVDLGVLTATSVWMAEQL
GRPSPSRTVRALSHKE
NT seq 951 nt   +upstreamnt  +downstreamnt
gtgaccgacaccggactgcccatgacggtgcccgcgcaggggctcccggaccgggtccgt
atccacgaggtcggcgcccgcgacggactgcagaacgagaagtccgtcgtgcccaccgag
gtgaaggcggagttcgtccgccggctcgcggaggcggggctctccacgatcgaggcgacc
agcttcgtgcacccgaagtgggtgccccaactggccgacgcggagcagctgttcccgatg
ctgggcgagatcgccgatgtcggggacgtggcactccccgtcctcgtgccgaacgaacgc
ggcctggaccgggcgctcgcgctcggtgcccgccggatcgccgtgttcggctcggccacg
gagacgttcgccgcgcgcaacctcaaccgcacggtggacgggtccctcgcgatgttcgag
ccggtggtggcccgggccaaggacgccggggtgcacgtgcgcggctatctgtcgatgtgc
ttcggcgatccgtgggagggcgcggttcccgtcccgcaggtcgtccgggtcgcgaaggcg
ctgatggacctcggctgcgacgagctctccctcggcgacacgatcggcgtcgccaccccg
ggccatgtgcgggaactgctctccgggctgaacgacgcgggtgtggccaccggcaccgtc
ggggtgcacttccacgacacgtacggtcaggcgctctccaacaccctggccgcgctccag
cacggggtgacgacggtggacgcctccgcgggcggcctcggcggctgcccgtacgcgaag
agcgcgaccggcaatctcgccaccgaggatctcgtgtggatgctcgacggcctcggtgtc
cacaccggggtcgatctcggcgtactcaccgccacaagcgtgtggatggccgaacaactg
ggccgtccgagcccgtcccgtaccgtccgcgcgctgtcccacaaggagtga

DBGET integrated database retrieval system