KEGG   Streptomyces pratensis: Sfla_4424Help
Entry
Sfla_4424         CDS       T01647                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00010  Glycolysis / Gluconeogenesis
sfa00052  Galactose metabolism
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01130  Biosynthesis of antibiotics
Module
sfa_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_4424
   00052 Galactose metabolism
    Sfla_4424
Enzymes [BR:sfa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Sfla_4424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADW05831
UniProt: E8WD46
Position
complement(5126057..5127049)
Genome map
AA seq 330 aa AA seqDB search
MTTGAAVHSEDFSVLDDGTPVRRWTLEREGTLVRVLTYGAVVQSVLVPGRDGDRAEVVLG
LPDVKGYETYTGPYFGAAVGRYANRIGGGSFVLDGRTHRLTRNEGGNTLHGGGRGFDKRV
WDAEEVPDGVRLTLVSEDGEEGFPGRLEVSVTYTLDEDAALRIAYRATTDAPTVVNLTNH
TYWNLAGADSGSALGHELRLAASLITPGDEWSIPTGEFVPVDGTRFDFREPKPVGPGYDT
NYVLEETGGEPVAELYDPASGRLLTVRTTEPGLQLYTADHLGGEPFVPCAGIALETQHFP
DSPNRPEFPSTVLRPGEEFASTTVYGFSVR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgggtgcggcggtacacagcgaagacttctcggtgctcgacgacggcacgccg
gtccgtcgctggaccctggaacgcgagggcaccctggtgcgggtgctgacgtacggcgcc
gtggtgcagtcggtcctggttcccggcagggacggggaccgggcggaggtggtcctgggg
ctgccggacgtcaaggggtacgagacgtacacgggcccgtacttcggcgccgccgtcggc
cgttacgcgaaccggatcgggggcggctccttcgtcctggacgggcgtacccaccggctc
acgcggaacgagggcggcaacacgctgcacggtggtgggcggggcttcgacaagcgcgtg
tgggacgccgaggaggtgccggacggcgtgcggctcaccctggtctccgaggacggcgag
gagggcttcccggggcggctggaggtgtcggtgacgtacaccctggacgaggacgccgcg
ctgcggatcgcctaccgggcgacgacggacgcgccgaccgtggtgaacctgacgaaccac
acgtactggaacctcgccggggcggacagcgggagcgccctcgggcacgaactgcggctc
gcggcctcgctgatcactcccggggacgagtggtcgatccccaccggggagttcgtaccg
gtggacgggacgcggttcgacttccgggagccgaagccggtggggcccggctacgacacc
aactacgtgctggaggagaccggcggggagccggtcgccgagctgtacgacccggcgtcg
gggcgtctgctcacggtccgcacgacggagccggggctccagctgtacacggcggaccac
ctgggcggtgagccgttcgtgccgtgcgccggcatcgcgctggagacgcagcacttcccg
gactccccgaaccggccggagttcccgagcacggtgctgcggccgggcgaggagttcgcc
tccacgacggtgtacgggttctcggtgcgctga

DBGET integrated database retrieval system