KEGG   Streptomyces pratensis: Sfla_4918Help
Entry
Sfla_4918         CDS       T01647                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00053  Ascorbate and aldarate metabolism
sfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Sfla_4918
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     Sfla_4918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 NAD_binding_4 Polysacc_synt_2 NmrA adh_short RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ADW06319
UniProt: E8W1X4
Position
complement(5666309..5667118)
Genome map
AA seq 269 aa AA seqDB search
MPAPRTVLLTGAAGGLGTLMRGLLPAYGYDLRLLDVAPVEGEPDAITADLGDRAALREAV
RGVDAVIHLAGISLEASFDKILRSNIEGTYNLYEAAREEGVGRIVFASSNHAIGYTPRPL
AGDPLIPVGTPRRPDTFYGLSKSFGEDLAQLYWDKHGVETVSVRIGSCFLEPTSVRMLSV
WMSPGDGARLFHAALTAEDVRHTVVYGSSDNTRLWWDLTTARSLGYDPQDDSEQYAEKLV
AEQGELDPDNPDHAHLGGHFVTNPPIWPH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccccgtaccgtccttctcaccggcgccgccggcggcctgggcaccctgatg
cggggactgctccccgcgtacggctacgacctccgcctcctcgacgtcgctcccgtcgag
ggcgagccggacgcgatcaccgccgatctcggcgacagggccgcactgcgggaggccgta
cggggcgtcgacgcggtgatccacctggcgggcatctccctcgaagcctcgttcgacaag
atcctgcgctccaacatcgaaggcacgtacaacctctacgaggcggcacgcgaggagggc
gtcgggcggatcgtgttcgcctcctccaaccacgccatcggctacaccccccgcccgctc
gcgggtgatccgctgatccccgtcgggaccccccgccgccccgacaccttctacgggctg
tcgaagtccttcggcgaggacctcgcccagctctactgggacaagcacggcgtggagacc
gtctccgtgcgcatcggctcctgcttcctggaaccgacgtcggtgcggatgctgtccgtc
tggatgagccccggcgacggagcgcgcctcttccacgcggccctcaccgccgaggacgtg
cggcacaccgtggtctacggctcgtccgacaacacccgcctgtggtgggacctgaccacg
gcccgctccctcggctacgacccgcaggacgactccgagcagtacgcggagaagctcgtc
gccgagcagggcgaactggacccggacaaccccgaccacgcccacctcggcggccacttc
gtcacgaaccccccgatctggccccactga

DBGET integrated database retrieval system