KEGG   Streptomyces pratensis: Sfla_6028Help
Entry
Sfla_6028         CDS       T01647                                 

Definition
(GenBank) Terpene synthase metal-binding domain-containing protein
  KO
K10187  germacradienol/geosmin synthase [EC:4.2.3.22 4.2.3.75 4.1.99.16]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00909  Sesquiterpenoid and triterpenoid biosynthesis
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    Sfla_6028
Enzymes [BR:sfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.16  geosmin synthase
     Sfla_6028
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.22  germacradienol synthase
     Sfla_6028
    4.2.3.75  (-)-germacrene D synthase
     Sfla_6028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terpene_synth_C
Motif
Other DBs
NCBI-ProteinID: ADW07414
UniProt: E8W0U2
Position
complement(6908993..6911236)
Genome map
AA seq 747 aa AA seqDB search
MAQPFSLPEFYVPYPARLNPHLDAARSHTREWARGMGMLEGSGIWEEKDLESHDYALLCA
YTHPDCSSEALSLVTDWYVWVFFFDDHFLELFKRTPDREGGRKYLDRLPAFMPMERGAAT
PEPANPVEAGLADLWTRTVPAMSDAWRARFAESTANLLNESLWELSNINEGRIANPVEYI
EMRRKVGGAPWSAGLVEYAANAEVPASLADARPLRVLRDAFSDGVHLRNDLFSYQREVED
EGENSNGVLVLERFLDCSTQEAADAVNDLLTSRLHQFENTALTELPPLCAEKGLGPDETA
AVLAYVKGLQDWQSGGHEWHMRSSRYMNGGPSATGTTSGFGMAAASVRLTPRSESARLRS
LTHVPYRHVGPSLLPDFEMPFTTTLSPHLGGARVRIVEWSRRMGLLEAQPGVPGSYIWDE
ARLIATDLPLCAAGLHPDATPEELDLSSGWLTWGTYGDDWFPVVHGRSRDLAGARVANER
LSLFMPLDGASAPEPANALERGLADLWRRTAAPMDGAARRMFRAAVESMTASWLWELANQ
AQNRIPDPVDYMEMRRATFGSDLTMSLCRLGHGRKVPDEVYRSGPLRSLENAAADYACLM
NDLFSYQKEIEYEGEVHNGVLVVQNFFGVDYPTGVAIVHDLMKGRMEQFQHVAEHELPLL
CEEFGLDTEARETLSGYVRELRHWLAGILIWHRGCRRYREEDLRRGSGAPWHLGGPTGLG
TSAAQVIRLLTEQGRFSPAGRVRRAAV
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcccttctcactgccggagttctacgtgccgtatccggcgcgtctcaaccct
cacctggacgcggcccgcagccacacccgggagtgggcgcgcgggatggggatgctggag
gggtccggaatctgggaggagaaggacctcgagtcccacgactacgcgctgctctgcgcg
tacacccatcccgactgctcgtccgaggcgctgtccctggtcaccgactggtatgtgtgg
gtcttcttcttcgacgaccatttcctggagctcttcaaacgcactccggacagggagggc
ggcaggaagtacctcgaccggctgcccgccttcatgccgatggagaggggtgcggcgaca
cccgagccggccaatccggtggaggcgggactggccgacctgtggacgaggaccgttccg
gcgatgtcggacgcctggcgggcccggttcgcggagtcgacggcgaacctgctcaacgag
tccttgtgggagctctcgaacatcaacgagggcaggatcgcgaatccggtcgagtacatc
gagatgcggcgcaaggtgggcggggccccctggtcggcgggcctggtggagtacgcggcg
aacgcggaggttcccgcctcgctggcggacgcccgtccgctgcgggtgctgcgggacgcg
ttctccgacggggtccatctgcgcaacgacctcttctcctaccagcgtgaggtcgaggac
gagggcgagaacagcaacggcgtgctggtcctggagaggttcctcgactgctcgacccag
gaggcggcggacgccgtcaacgatctgctgacctcacgtctccaccagttcgagaacacc
gccctgaccgaactgcccccgctctgcgcggagaagggcctcggcccggacgagacggcc
gccgttctcgcgtacgtcaagggtcttcaggactggcagtccggcgggcacgagtggcac
atgcgctccagccggtacatgaacggcgggccctcggccaccgggaccacgtccggcttc
gggatggccgccgcgtccgtccgcctcacgccccgctcggagtcggctcggctcaggagc
ctgacccatgtcccgtacaggcacgtcggcccgtcactgctgccggacttcgagatgcct
ttcaccaccacgctgagcccccatctcggcggggcacgggtgcggatcgtggagtggtca
cggcggatggggctgctggaggcgcagccgggggtaccgggttcgtacatctgggacgag
gcccggctgatcgccacggacctgccgctgtgcgcggcaggcctgcaccccgacgcgaca
ccggaggaactggacctgtcgtcgggctggctgacctggggaacgtacggcgacgactgg
ttccctgtggtgcacggccggtcccgcgatctggcgggggcacgcgtcgccaacgagcgg
ctgtcgctgttcatgccgctcgacggggcatccgcgcccgagccggccaacgcgctggaa
cgggggctggccgatctgtggaggcggacggcggcaccgatggacggcgcggcgcggcgc
atgttccgggccgccgtggaatcgatgacggcgagctggctgtgggagctggcgaaccag
gcgcagaaccggatccccgacccggtcgactacatggagatgcgccgcgccacgttcggt
tcggacctcacgatgagcctgtgccggctgggccacggcaggaaggtgccggacgaggtc
taccgcagtggtccgctgcggtcactggagaacgcggcggccgactacgcgtgtctgatg
aacgacctgttctcctaccagaaggagatcgagtacgagggtgaggtgcacaacggcgtc
ctggtcgtgcagaacttcttcggggtggactacccgacgggggtggcgatcgtgcacgac
ctcatgaaggggcggatggagcagttccagcatgtggccgagcacgaacttccccttctc
tgcgaagagttcggcctggacacggaggcgcgggagacgctgtcgggctatgtgcgggag
ctccggcactggctggcgggaatcctgatctggcaccggggctgcaggcgctaccgcgag
gaggacctgcggcggggaagcggcgccccgtggcacctcggcgggcccacggggttgggg
acgtcggccgcccaggtgatccggctgctgacggagcagggacgtttcagccctgctgga
agagttcggcgggcagcggtttga

DBGET integrated database retrieval system