KEGG   Spirochaeta africana: Spiaf_0130Help
Entry
Spiaf_0130        CDS       T01811                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sfc  Spirochaeta africana
Pathway
sfc00020  Citrate cycle (TCA cycle)
sfc00640  Propanoate metabolism
sfc00660  C5-Branched dibasic acid metabolism
sfc01100  Metabolic pathways
sfc01110  Biosynthesis of secondary metabolites
sfc01120  Microbial metabolism in diverse environments
sfc01130  Biosynthesis of antibiotics
sfc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Spiaf_0130
   00640 Propanoate metabolism
    Spiaf_0130
   00660 C5-Branched dibasic acid metabolism
    Spiaf_0130
Enzymes [BR:sfc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Spiaf_0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA
Motif
Other DBs
NCBI-ProteinID: AFG36239
UniProt: H9UFE6
Position
157495..158721
Genome map
AA seq 408 aa AA seqDB search
MRLLEYQGKDVFRRAGLAVPQARLLTVESPGQCAEAVRTAAGELLQTGGAEHDAKKPATA
GAGPDAAEPATAGAARVVVKAQVNMGGRGKAGLIKLADSPDTAAAAAAEILATPYSVPRL
LVEEAVDLERELYLSISPDAGSARFIVLASLEGGVEIEELARERPDAIKRLSIDPIAGLQ
PYQSRELAYDLGLAGDVARQFARLVAALYRVFRDNDAELAEINPVFLTRDGRLVAGDAKL
IIDDNSLDRQPQFEISREQFESDAAYESALEGIPYVQFDGDISLMCAGAGLTTTVYDLVN
FEGGTVANYLEFGGPNYHKAQRAMELCLQNRSKVILVVTFGTIARADVMADGVVEAIRNL
QPDRPIVTCIRGTNEEAAEQTLRAAGLEPLFDAEEAVRTAVALARERA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgagattacttgagtatcagggaaaggacgtgttccgtcgtgccggtctggcggtgccg
caggcgcgcctgctgacggtcgagtcacccgggcaatgcgccgaagcggtccggaccgca
gccggggaactgctgcagaccggtggcgccgaacatgatgcaaaaaagccggcaactgcc
ggtgccggaccggacgccgcggagccggcaactgccggtgctgcccgggttgtggtaaag
gcgcaggtgaacatgggggggcgcggcaaggccgggttgatcaagctggccgacagcccg
gatacagcagccgcggcggctgcagagatcctggcgaccccctacagcgtgccccggctg
ctggtcgaggaagcggttgatcttgaacgtgaactgtacctctcgatctcgccggatgcc
ggcagcgcccgctttatcgttctggcgtcgctggaaggcggggtggagatcgaggagctg
gccagggagcgccccgatgcaatcaagcggctgtccattgatccgatcgcgggactgcag
ccgtaccagagtcgggaactggcgtatgatctggggcttgccggcgatgttgccagacag
tttgcccgtctggttgccgccctgtaccgcgtgtttcgcgacaacgatgccgagctggcc
gagatcaacccggtattcctgacgcgcgacggcaggctggtggccggggatgccaagctg
attatcgatgacaacagtctggaccggcagccgcagttcgagataagtcgcgagcagttc
gagtcggatgcggcctatgagtccgccctggaggggataccctatgtgcagtttgatggg
gatatctcgttgatgtgcgcaggggccggtcttaccaccacggtttatgacctggtgaat
ttcgagggcggtactgtcgccaactatctggaattcggcgggccaaactatcacaaggca
cagcgggccatggagctgtgtctgcagaaccgcagcaaggtgatcctggtggtgaccttt
ggcacgattgcccgggctgatgtaatggccgacggggtggtagaggccatccgtaatctt
cagcccgatcgcccgatcgtcacctgcattcgcggtaccaacgaggaagcagccgaacag
accctgcgggcggccggactggagccactgttcgatgccgaagaggcggttcgcaccgcc
gtagcgctggcccgggagagagcataa

DBGET integrated database retrieval system