KEGG   Spirochaeta africana: Spiaf_0312Help
Entry
Spiaf_0312        CDS       T01811                                 

Definition
(GenBank) hypothetical protein
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFG36420
UniProt: H9UFX7
Position
389795..390649
Genome map
AA seq 284 aa AA seqDB search
MCAILLVLTGYPAAARDYPEPPEVANPLYRYEPVGSADGPPLRIAAGFFGRFWYDHATVS
TGGEDVFTVGVQGSSLALAWRDRLVLQPHFASILVVGPVAADEQAATIAEWWMNAVQYQY
GLHAAHRSRFGDLVVGYRRTSLHPLRKGYSEISRDQFFAGLGRDFEPWYLAVYLRYSDLW
ELWESGLPQPRNRLVLELQAAAEHTLRRDLQVFAELQPRLLLNRYGPTMELEPVGRVGVR
VGSQGSRLELYLHGYRTHDTEQLRDRRYATTVIGLGVAAAGHGK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtgccatccttctggtgctgaccgggtacccggctgcagccagggattatccggag
cctccggaggtcgccaacccgttgtaccggtatgaaccggtcggttcagcggatggtccg
ccgctccgcattgcggcagggtttttcggccggttctggtatgaccatgccaccgtgagc
accggtggcgaggatgtattcaccgtcggtgtacagggatcttccctggcgctggcatgg
cgggatcggctggtgctccagccacacttcgccagtatcctggtagtcggtccggtggcg
gcggatgaacaggcagcaacgatcgccgaatggtggatgaatgctgtccagtatcagtac
gggctgcatgctgcacaccggagccgcttcggggacctggttgtcggctaccggcgtacc
agcctgcatcccctgcgcaagggctactcggagatcagccgggaccagttttttgccggc
ttgggccgtgattttgagccctggtatctcgccgtctacctgcggtacagcgatctgtgg
gagttgtgggagagtggattgccgcagccgcgtaacaggctggttctggagctgcaggct
gctgccgagcacaccctgaggcgggatctgcaggtatttgcagaactccagccgagactg
ctgctgaatcgctacggcccgaccatggagttggagccagtgggcagggtcggggtgcgg
gttggctcgcaaggttcccggctggagctgtatctgcatggctatcgcacccacgacaca
gaacagctgcgtgaccggcgctatgctacaacggtaatcgggctgggcgtggcggcggcc
gggcacggaaagtaa

DBGET integrated database retrieval system