KEGG   Spirochaeta africana: Spiaf_0322Help
Entry
Spiaf_0322        CDS       T01811                                 

Definition
(GenBank) uncharacterized protein with conserved CXXC pairs
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1667 Molybdop_Fe4S4
Motif
Other DBs
NCBI-ProteinID: AFG36429
UniProt: H9UFY6
Position
complement(399272..399631)
Genome map
AA seq 119 aa AA seqDB search
MSQKKEMICIACPIGCRLTVAPKGDGITVSGNKCKRGEVYAQEEWFSPKRMVTTTCRVSG
SPLLARVPVRTTAALPIEHIDQLLQDLHDRQLEAPLPIGSVIEADVAGTGVDVITSHSI
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagaaaaaagaaatgatttgtatcgcctgtccgatcggctgtcgccttaccgtt
gcgccgaaaggagacgggattacggtctccggcaacaaatgcaagcgcggcgaggtgtat
gcccaggaagaatggttctctcccaagcggatggttaccactacctgccgggtcagtgga
tcaccgctgctggcccgggttccggtacgaacaaccgccgcactgccgattgagcatatc
gaccagctcttgcaggacctgcatgaccgccagctggaagccccgctgccgatcgggtcg
gtgatcgaggccgatgtggccggtaccggggtggatgtgatcacctcacacagcatctaa

DBGET integrated database retrieval system