KEGG   Spirochaeta africana: Spiaf_0323Help
Entry
Spiaf_0323        CDS       T01811                                 

Definition
(GenBank) thioredoxin reductase
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 FAD_binding_2 Pyr_redox_3 Pyr_redox FAD_oxidored NAD_binding_8 DAO Thi4 HI0933_like FAD_binding_3 GIDA Lycopene_cycl AdoHcyase_NAD NAD_binding_7 2-Hacid_dh_C AcetDehyd-dimer F420_oxidored ApbA Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: AFG36430
UniProt: H9UFY7
Position
complement(399628..400893)
Genome map
AA seq 421 aa AA seqDB search
MRNQSYDAIVIGGGAAGMSAAAEIARRGYSTAIIERDPVLGGILLQCIHNGFGLHEFKEE
LTGPEYAERWEHLVAQENIDVFCDTTVIDMSESGDASDAKTAVCVSPREGMFQLSARAVV
LATGCRERNRGGIRIPGTRPAGVYTAGLAQRMVNLEGYLPGKDIVIVGSGDIGLIMARRM
TWSGCKVHAVVEIQPYPSGLTRNISQCLNDFDIPLYLSHVVSGIHGKRRVESVDITPLEG
GRPDHDATFSIECDTLLLSVGLIPSHELARTLGAELNPLTNGPMVDSRMMTTVPGLFSCG
NVLHVHDLVDFVSAESRRAGAHVAEYLQGYQPSRQVRIKPGANIRYVAPAAHNPERPEII
YFRPMIVKNDAVVQVLMDSAVIKEYKKSHVQPSEMIEINMKKLKLDPARIRKDSVLEVRL
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaccagagctatgatgcaatcgtaatcggcggcggcgccgccggcatgtcggcg
gctgccgagatcgcccgtcgcggctacagcaccgcaatcatcgagcgggaccccgtcctg
ggcgggatcctgctgcagtgtatccacaacgggttcgggctgcatgagttcaaggaggaa
ctgaccggtccggagtacgccgagcgctgggaacacctggtggcgcaggaaaacatcgat
gtgttctgtgacaccaccgtgatcgacatgagcgagtccggcgacgccagcgatgccaag
acggcggtatgtgtctcgccccgggaagggatgttccagctctcggcacgggcggtggta
ctggccaccggatgtcgcgagcgcaaccggggaggcattcgcatcccgggaaccagacca
gccggggtctataccgccgggctggcacagcggatggtcaatctggaaggctaccttccc
ggcaaggacatcgttatcgtcggttccggagatatcgggctgatcatggcccgtcgcatg
acctggtccggctgcaaggtccatgcggtagtcgagattcagccctatccgtcgggactc
acccgcaacatatcccagtgtctgaatgacttcgatatcccgctgtatctgagccatgtg
gtgtccgggatacacgggaaacggcgggtcgaatcggtggacatcaccccgctggagggg
ggacgccccgaccacgatgccaccttttcgatcgagtgcgacaccctgctcctgtcggtc
ggcctgatcccctcacatgaactggcccgcaccctgggagccgagctcaatccgctgacc
aacggtccgatggtagacagccggatgatgaccacggtacccggactgttctcctgcgga
aacgtgctgcatgtgcatgacctggtcgactttgtatcggccgagtcgcgacgagccggg
gcccatgttgccgaatacctgcagggctaccagccgtcgcggcaggtgcgcatcaaaccg
ggagcaaacatccgctatgtcgcacccgccgcgcacaaccccgaacgccccgagatcatc
tacttccggccaatgatcgtcaagaacgatgcggtggtacaggttctgatggactcggcg
gttatcaaggagtataaaaaatcccatgtacagccctcggagatgatcgagatcaacatg
aagaaactcaagctggatccggccaggattcgcaaggattcggtactggaggtacgtctg
caatga

DBGET integrated database retrieval system