KEGG   Spirochaeta africana: Spiaf_0326Help
Entry
Spiaf_0326        CDS       T01811                                 

Definition
(GenBank) hypothetical protein
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4168 EF_assoc_2 PDH
Motif
Other DBs
NCBI-ProteinID: AFG36433
UniProt: H9UFZ0
Position
complement(404125..404610)
Genome map
AA seq 161 aa AA seqDB search
MKNHTKHVMAIGISLMVLLAFAAAPLSAQQFPAQDPPEQDFSDAEIEAFAAALVEIETIQ
SSMQQELNDIIENGSMDSERFYELHSHFTQTQGTLPEDISSSEEAEFQETFQALVAAEET
TQTQMIDAVESEGLDVETFNSIVAVAQQNPELWEEIQSHQQ
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcataccaaacacgttatggcaatcggtatctcactgatggttttactggcc
tttgcggcggcgccgctgagcgcccagcagtttccggcccaggatccgccggaacaggat
ttctcggacgccgaaatcgaggcctttgctgccgcactggtagagatagaaaccatccag
agcagcatgcagcaggaattgaatgacatcatcgagaatggcagcatggactcggagcgc
ttctacgagctgcactcccactttacccagacccaggggaccctgcccgaggatatttca
tcctcagaagaggccgaattccaggaaacctttcaggccctggttgccgccgaggaaacc
acccagacccagatgatcgacgctgtcgaaagcgagggcctggatgtcgaaacctttaac
tccatcgtagctgtggcccagcagaatcccgaactctgggaagaaatccagagccaccaa
cagtaa

DBGET integrated database retrieval system