KEGG   Spirochaeta africana: Spiaf_0329Help
Entry
Spiaf_0329        CDS       T01811                                 

Definition
(GenBank) signal transduction histidine kinase
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA IncA Lzipper-MIP1 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AFG36436
UniProt: H9UFZ3
Position
406334..407698
Genome map
AA seq 454 aa AA seqDB search
MTRQITVLGYSFRLMLLSVLIVVVVFAAIMSMALQRAINDWNTIRNQNLQTTIGAAIAQN
YRLEGSLSPELLQQVLRPMLSPTVYVVVADSERNPLYAFVRGERVPLHPESTLDSVLQQV
AGTVALPNVLLDGDEIFGYVAAGSLGFASDPLNLRFLRSLGFFLSLGVGLAIGVGLLSAF
LLSRMLSNHARRVSGFLARIAAGERDIELPAERVHEFQNILESVRGLQQQLKREEELRRH
WARDVAHDLRTPITALQAQFEAMQQGIVPATAERLASLRHEVARIERLVLDLRALNTMEE
PQHELHPEWLDAEDFLRTAIASFGVGTGAGRFRLACTVDRLYADPHALQRAVMNLMQNAV
QHGTPGTDIGIALRPTGASDPSLILEICNAGGVPAQDLPYVFERLYRGEDSRTTPGSGLG
LSIAKAIIERHGGRIELDSDGSVTTVTVLLPNGG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgacccggcagattaccgttcttggctacagcttccgtcttatgctgctctcggtgctt
attgtggtggtggtctttgcggcgatcatgtcgatggcgctgcagcgagccatcaatgac
tggaacaccatccggaatcagaacctgcagaccacgatcggggcagctatcgcccagaac
tatcggttggagggcagcctgagtcccgagctgctgcagcaggtgttgcggccaatgctg
agtccgacggtgtatgtggtggttgccgattccgagcgcaatcccctgtatgcctttgta
cgcggcgagcgggttccgctgcatccggagagcaccctggactcggtgctgcagcaggtt
gccggtacggtagcattgccgaatgtcctgctggatggggacgagatattcggctacgtt
gctgccgggtcgctggggtttgcttccgatccgctgaatctgcggttcctgcgatcgctc
ggcttttttctgagcctgggcgtcggcctggcgattggcgttggtctgctgtctgccttt
ctgctttcccggatgctgtcgaaccacgcccgtcgggtgtcgggattcctggcccggatt
gctgccggagagcgggatatcgagctcccggctgaacgggtacatgagtttcagaatatt
ctggaatctgtgcgcggcctgcagcagcagctgaagcgggaagaggagctgcggcgccac
tgggcgcgagatgtggcccatgatctgcgtaccccgatcaccgctctgcaggctcagttc
gaggccatgcagcaggggatcgtccctgccacggccgagcgactggcatccctgcgtcat
gaggtggcgaggatcgagcggctggtgcttgatctgcgtgccctgaataccatggaggag
ccgcagcatgagctgcaccccgaatggctggatgccgaggatttcctgcggacggcgatt
gccagttttggtgtcggcacaggggcggggcggtttcgccttgcctgcacggtagacagg
ttgtatgcagacccgcatgccctgcagcgtgcagtcatgaatctgatgcagaacgccgtg
cagcatggcacccccggtacggatatcgggattgcgctgcggcccaccggggcttccgac
ccctcgctaatactggagatatgcaatgccggcggggtaccggcacaggatctgccttat
gtgtttgaacggttgtaccggggcgaggactcgcggactacacccggcagcggactgggg
ctctcgatagccaaggcaataatcgaacgtcatgggggtcggatcgagctggattcggat
ggatcggttaccactgtcacggtgctgctaccgaacgggggctag

DBGET integrated database retrieval system