KEGG   Spirochaeta africana: Spiaf_0331Help
Entry
Spiaf_0331        CDS       T01811                                 

Definition
(GenBank) hypothetical protein
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFG36437
UniProt: H9UFZ4
Position
407977..408324
Genome map
AA seq 115 aa AA seqDB search
MAVVLIAVAAGCASAPAQPAEPLEIMIDSEGPLVIYWTNRAFTGDFHITWSLDSDPEYPP
RSQDYAVTRTAEQDMDYELVGFEGPGFYHVRVAAEVDGEVVYSDSLQLYLAGGTP
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgtactgatagctgtcgccgcaggctgtgcgtcggcaccggctcagccggcc
gaaccgttggagatcatgattgattctgaaggtccgttggtcatttactggaccaaccgt
gcgttcaccggggattttcacattacctggtcgcttgactctgatccggaatacccgccg
cgatcgcaggactatgccgtaacccgaaccgcagaacaggatatggactatgagctggtc
ggatttgaaggcccggggttctaccatgtgcgggttgctgccgaggtggatggcgaggtg
gtctactccgattcgctgcagctgtatcttgccgggggtaccccgtag

DBGET integrated database retrieval system