KEGG   Spirochaeta africana: Spiaf_0333Help
Entry
Spiaf_0333        CDS       T01811                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00057  glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
sfc  Spirochaeta africana
Pathway
sfc00564  Glycerophospholipid metabolism
sfc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Spiaf_0333
Enzymes [BR:sfc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     Spiaf_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_Gly3P_dh_N NAD_Gly3P_dh_C ApbA 3HCDH_N F420_oxidored 2-Hacid_dh_C NAD_binding_2 Shikimate_DH IlvN NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFG36439
UniProt: H9UFZ6
Position
complement(408686..409747)
Genome map
AA seq 353 aa AA seqDB search
MSTHHVGIIGAGAWGTAIAKILGDKGVSVTIWSYEQEVADSITRQHSNDRYLPGFTLPDS
VTADTDLTAVAADKDYLIIATPSLFTLPTIRSIVTVPAIAEGRTSIGILTKGFITTPRGT
RLIVETLEDYLPGFYKGNLTYISGPSHAEEVAQGKLTGLISASQNPKKSILFRNLLNSPT
LKVFSSLDTIGVQVCGAMKNVVAIAFGMLDALYERSGGIVGDNTESLLLAAGLNEIQTMG
MALGSTHPETFTSIAGVGDLDVTCRSQYGRNRRFGREIILENKLAPYADIDALIADITGL
GYLPEGAVAARAAWTVIQQRGLKMPVSAGVYKILNREADPDNAVELILSGRSE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacatcatgtcggtattattggcgcaggtgcctggggcactgccatcgcaaag
atactgggagataaaggggtttcggtaaccatctggtcatacgagcaggaggtggctgac
agcattacccgccagcacagcaacgatcgctatctgccgggattcaccctgcctgacagc
gtcaccgcagacaccgatctgacggcggttgccgcggacaaggactacctgatcatcgcg
accccgtcgctgttcaccctgcccaccattcgctcgatcgtaaccgtgccggcgatagcc
gagggtcgcaccagcatcgggattctgacaaagggatttatcaccaccccgcggggaaca
cggctgatcgtagagacactcgaggactatctgcccggtttctacaagggcaacctgacc
tatatatccggcccgagccatgccgaggaggttgcccagggcaagctgaccggattgatc
agcgcatcacagaaccccaagaaaagcattctgttccggaacctgctgaactcgccgacc
ctgaaggtgttttcatcgctggataccatcggcgtacaggtctgcggtgccatgaagaac
gtagttgccattgcattcgggatgctggatgcactgtatgagcgcagcggcgggatcgtt
ggtgataataccgagtccctgctgctggcagccgggttgaacgagatacagaccatggga
atggcactgggttctacccatcccgaaacctttaccagcattgccggggtcggcgacctg
gatgtgacctgccgcagccagtatgggcgcaaccggcgtttcggccgggagatcattctg
gagaacaagctggcaccgtatgcggatatcgatgcacttatcgccgacattaccggcctg
ggatacctgccagagggtgcggttgccgcccgggcagcctggaccgtgatccagcagcgc
gggctgaaaatgccggtctcggctggtgtatacaagatactcaaccgcgaagccgatccg
gacaacgcggtcgagctgatactgagcgggcgcagcgagtag

DBGET integrated database retrieval system