KEGG   Spirochaeta africana: Spiaf_0338Help
Entry
Spiaf_0338        CDS       T01811                                 

Definition
(GenBank) Na+/proline symporter
  KO
K03307  solute:Na+ symporter, SSS family
Organism
sfc  Spirochaeta africana
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Spiaf_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-ProteinID: AFG36444
UniProt: H9UG01
Position
complement(413705..415180)
Genome map
AA seq 491 aa AA seqDB search
MNQWLIWGAMAAWTLVTLLVAVRAGRDLRGGAAEFFIGGRRIKGFVSGMTYAATTYSAFM
LVGLVGLTYSSGVGAYGFEMTYLLCTVLLLVVFGPRFFVVGRRFAHVTPPELLANRLQHN
GVALTAAIISFVMLIPYSAVQMMGAGFLVEGLTGGDVPFMAGVLVMAVLAGVSALWAGMR
SVAWTDALQAMTMLITSLTALLYIAFRYFGSPLEFARTIERSHAELLQLTWDPNLFIGLT
LPWAFFALTNPQVSQRMYVPDSPRSLRRMIMYFSVFGGIYTVISILFGYQAAALLPGLEN
PDSAMPVLLSRIPAGIGLIMFLGIFAAATSTLGSLILTLSSLLSRDVVRIFKPDISDRRE
RTIGKLGMVILLLAGTGFAALRPGLITVLSSMSSGGLLVMAPTIVAVFFWKRVTAAGAMV
SMIAAGLLTAGLYISGWYPWGIWPPVWGLGLSTLLLMIVSRFTSPPANAAEWLDHLRQDL
QAAGFTRRKRS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagtggctgatctggggcgccatggctgcctggacactcgttaccctgctggtt
gcggtacgggccggtcgtgatctgcgcggcggtgctgccgaattttttatcggcgggcgg
cgcatcaaggggtttgtatccggcatgacctatgccgccaccacctacagcgcttttatg
ctggtcggtctggtcggcctgacctatagcagcggggtaggcgcctacggcttcgagatg
acctatctgctgtgcacggtgttgctgctggtggtgttcgggccgcgcttctttgtggtc
gggcgtcgctttgcacatgtcaccccgcccgaactgctggcgaaccgcttgcagcacaat
ggtgtcgcgctcaccgccgcaatcatctcgtttgtgatgctgatcccctactcggcggtc
caaatgatgggtgccgggttcctggtcgaggggctgaccggcggtgatgtgccgtttatg
gccggggtactcgtaatggcggtgcttgccggggtcagtgcgctgtgggccgggatgcga
tcggtcgcctggaccgatgccctgcaggcaatgaccatgctgattaccagcctgaccgca
ctgctgtacatcgcgttccggtacttcggttcaccccttgagtttgcccgcacgatagag
cgcagccatgcagagctgctgcagcttacctgggatccgaacctgtttatcgggcttacc
ctgccgtgggccttctttgcattgaccaatccccaggtttcccagcggatgtatgtaccc
gactcgccgcgcagcctgcgccggatgatcatgtacttctcggtgttcggcggcatctac
accgtcatttcgatactctttggctatcaggcagcggccctgctgccggggctggagaac
cccgacagtgccatgccggtactgctgagcaggatcccggccggtatcggccttatcatg
tttctggggatctttgcggcagcaaccagcacacttggctcgctgatactcaccctgagc
tccctgctgtcgcgggacgtggtgcgaatcttcaagcccgatatctccgatcgccgggaa
cgtacaatcggcaagctcggcatggttatcctgctgctggccggcaccgggttcgccgcg
ctgcggcccgggctgattaccgtgctgtccagcatgtccagcgggggactgctggtgatg
gccccgaccatagtcgcggtgtttttctggaagcgggtaaccgcagccggtgctatggtg
tccatgattgccgccgggctgctgactgccggtctgtacataagcggctggtatccctgg
gggatctggccgccggtctggggactgggactgagcaccctgctgctgatgattgtcagt
cgattcaccagccctccggccaatgccgctgagtggctggatcacctgcggcaggatctg
caggcggccggatttacccggcgaaaacggagctaa

DBGET integrated database retrieval system