KEGG   Spirochaeta africana: Spiaf_0361Help
Entry
Spiaf_0361        CDS       T01811                                 

Definition
(GenBank) HPt domain-containing protein
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hpt HSCB_C
Motif
Other DBs
NCBI-ProteinID: AFG36466
UniProt: H9UG23
Position
440613..440963
Genome map
AA seq 116 aa AA seqDB search
MNHYTQRFERFVARFSGHEEVVARMAGLFLQDAPRRLDEIDSGYRERDWERVITAAHSLV
NIAGTMQAFEAAEQARKLEAAVRARAYAEIPQLSSCLQSDLQQALQVVHSYSEASV
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgaatcactacacacagcgatttgagcggtttgtggccaggttttccgggcacgaggag
gtggtcgctcgcatggcagggctgttcctgcaggatgcaccgcgcaggctggatgaaata
gacagtggctaccgggagcgtgactgggagcgggttattaccgctgcccacagcctggtc
aacatagccggaaccatgcaggccttcgaggcggccgagcaggcgcgcaagctggaggcg
gcggtgcgtgccagggcgtatgccgaaattccccagctcagctcttgcctgcagagtgat
ctgcagcaggcgctgcaggtcgtgcattcctattcagaggcctcggtgtag

DBGET integrated database retrieval system