KEGG   Spirochaeta africana: Spiaf_0365Help
Entry
Spiaf_0365        CDS       T01811                                 

Definition
(GenBank) hypothetical protein
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2205 TPD52 ABC_tran_CTD Tektin Peptidase_M78 Seryl_tRNA_N Glutaredoxin2_C SlyX
Motif
Other DBs
NCBI-ProteinID: AFG36470
UniProt: H9UG27
Position
complement(446346..447146)
Genome map
AA seq 266 aa AA seqDB search
MNQDQIKDQLLKLEPDVEEFFVILSGKQSKRVNGLYKPDTREIIIHNKNFGDDNEMMYTA
IHEFAHHVHITNSLVPVGPRAHTVEFRNILHELLGRAERLGVFRNVFDTTPEFQELTNRI
REQFMRQNGRLMKEFGAVLGEAAELCRRYNARFEDYVERILGINTKDANTVIKFHAFNVN
PDLGYENMKTVANIRNEKERLRAENAFLSGESPDSVKRSLSTRGNEDEDPIEKLKREKRR
IERTINSLQQKLSAVEQRLAGVGEAD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggatcagatcaaggaccagctgctcaagctggaaccggatgtggaggagttc
ttcgtgatcctctccgggaagcagagtaaacgggtgaacgggctgtacaaacccgacacc
cgtgagattattatccacaacaagaactttggcgatgacaacgagatgatgtacaccgcc
attcacgagttcgctcatcatgtccacatcaccaacagcctggtgccggtgggtccgcga
gcgcacacggtcgagttccgcaacatcctgcatgaactgctgggacgtgccgaacggctg
ggcgtcttccgcaatgtgttcgacaccaccccggagttccaggaactgaccaaccggatt
cgcgagcagttcatgcgccagaacgggcggctcatgaaggagttcggtgcagtgcttggt
gaggccgcagagctgtgcagacggtacaacgcccgattcgaagactatgtggagcggatc
ctgggtatcaacaccaaggacgccaatacggtaatcaaatttcatgcctttaacgtaaat
cccgatctgggctatgaaaacatgaagactgtagccaacattcgcaacgagaaggaacgc
ctgcgcgccgagaacgccttcctgtccggtgaaagccccgacagcgtcaagcgttcgctg
agcactcgcggaaacgaggatgaagacccgatcgaaaaactcaagcgggagaaacggcgg
atcgaacgcaccatcaacagtctgcagcagaagctcagcgctgttgaacagcggcttgcc
ggcgtcggggaggccgattaa

DBGET integrated database retrieval system