KEGG   Spirochaeta africana: Spiaf_0369Help
Entry
Spiaf_0369        CDS       T01811                                 

Definition
(GenBank) hypothetical protein
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AATase
Motif
Other DBs
NCBI-ProteinID: AFG36474
UniProt: H9UG31
Position
451070..452434
Genome map
AA seq 454 aa AA seqDB search
MKQPLEFRGFRHHSGRHQEGSVWMPLDNAAKIFPAIQGTRYSTLFRLAVVLDHPVRLPQL
QAALQRVMRRYPYFQVELRRGFFWYYLERLEEAPQVMADGRSPCTRYNVHRPGAYLLRVR
AWQHRLAVEFCHVLTDGSGGAMFLRSLVTEYFRQCGTDISDWLDIPNPDTVPQPGEFQDA
NQIIGIEEFPPPVTRGAAFHVSGQMVPRHEYLVYSGLVSVAELLQHSRKLGVTITEYLTA
ALFWAYQEYIDDQPPAQARRWKKRPLRILLPVNLRPFYPTNTRRNFFVFVDPEIDLRLGR
YDFAELAQRIHAYMQIEVSRKNLNRHLSRNVGSERNWFIRLIPLYLKDLILKVVYRTSAE
RINSTSLSNLGRLQFPAEVEPHIRWAEFIPPPSPTYGISAGVVSHRETLCFSFGSLLQEA
EIERRFFRLLRRQGIHVTLKSNKEAVCPTAPNVV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagccgctggagtttcgcgggttccggcatcactcggggcgtcaccaggaggga
tcggtctggatgcccctggacaatgctgccaagatattcccggcaatccagggaacccgc
tattccaccctgttccggctggcggtggtactggatcatccggtgcgcctgccgcagctg
caggcagccctgcagcgggtgatgcggcgttatccgtactttcaggtggaactgcggcgg
ggattcttctggtactatctcgagcgtctggaggaggccccgcaggttatggccgacggc
cgttccccctgcacccggtataacgtacaccgcccgggcgcgtacctgctgcgcgtgcgc
gcctggcagcaccgcctggccgtagagttttgccacgtgctgaccgacggcagcggtggc
gccatgtttctgcgttcgctggttaccgagtattttcggcagtgcggaacggacatttct
gactggctggacattccgaatccggacaccgtgccgcagccgggcgagtttcaggatgcc
aatcagattatcggtatcgaggagttcccgccgccggtaacgcggggtgcggcctttcat
gtctccgggcagatggtgccgcgccacgagtacctggtgtacagcgggcttgtctccgtt
gccgaactgctgcagcacagccggaagcttggggttaccataaccgagtatctgaccgca
gccctgttctgggcataccaggagtacatcgacgaccagccgccggcacaggcccggcgc
tggaagaagcgacccctgcgcattctgctgccggttaacctgcgccccttttatcctacc
aacacacggcgcaacttctttgtctttgtcgatccggaaatcgacctgcgactggggcgt
tatgacttcgcggagctggcacagcggatccatgcctatatgcagatcgaggtatcccgc
aagaatctgaatcgacatctgtcgcgcaatgttggcagcgagcgaaactggtttatccgg
cttattccattatatctgaaggatctcattctcaaggtggtgtatcgcacctctgccgag
cggataaacagtaccagcctgtccaatctgggacggctgcagttcccggcagaggtggag
ccccatatccgctgggccgagtttatcccgccgccgagcccgacctacgggatttcggcc
ggtgtggtgtcgcatagggagaccctgtgcttttcctttggcagtctgctgcaggaagcc
gagattgaacggcggtttttccgtctgcttcggcgccagggaatccatgtcaccctgaaa
tccaacaaggaggccgtatgccctactgctccgaatgtggtgtag

DBGET integrated database retrieval system