KEGG   Spirochaeta africana: Spiaf_0370Help
Entry
Spiaf_0370        CDS       T01811                                 

Definition
(GenBank) hypothetical protein
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DZR zf-C3HC4_3 zinc_ribbon_2 Prok-RING_4 DUF2321 zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: AFG36475
UniProt: H9UG32
Position
452407..453126
Genome map
AA seq 239 aa AA seqDB search
MPYCSECGVEVDRSTRTCPLCSTPIYHATEPPSGEQGYAVSHEIEDMLARRPPGYARRLA
VQILTVVFLTPLLVAAVADWLVSGQLSWSLYVGVSMAALWVYSVVPILLYRRLWAILGVC
VTMTGLLMWSVDVLDPRTSWFWEVGLPVMAVIVVVTAAVAVLSVLSRTRGANIAGFILIG
IAVLCGAIDLISKRYMQLVGPPFTWSLIVAAAVGPVALFLLYYHYALSSRINLRKRLHL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgccctactgctccgaatgtggtgtagaggttgaccgctctacccgtacctgtcctctc
tgcagtaccccgatctaccatgctaccgaaccgccgtcgggtgagcagggctatgctgta
tctcacgagatcgaggatatgctggcccgaagacctccgggatatgccaggcggctggcg
gtccagatcctgacagtcgtgttccttacccccctgctggttgccgccgtcgctgactgg
ctggtcagcggtcaactctcctggtcgctgtatgtaggggtttctatggccgcattgtgg
gtatacagtgtggtgccgattctcttgtatcgccgattatgggcaatcctgggtgtgtgt
gtaaccatgaccgggctgctgatgtggtcggtcgatgtactcgacccgagaacctcctgg
ttctgggaggtcggccttccggttatggcagttattgtggtggttactgccgctgttgcg
gttttatcggtgctgtcccgcacccggggtgccaatattgccggatttatcctgatcggg
attgccgtgctgtgtggggcaatagatctgatcagcaagcggtacatgcagctggtcgga
cctccctttacctggtcgctgattgtagctgcggcggtggggccggttgctctgtttctg
ttgtactaccactacgctctgtcgagccgtatcaatcttcgcaagcgactgcacctgtag

DBGET integrated database retrieval system