KEGG   Spirochaeta africana: Spiaf_0371Help
Entry
Spiaf_0371        CDS       T01811                                 

Definition
(GenBank) lysophospholipase
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 DUF3530 DUF1749 Ser_hydrolase Thioesterase
Motif
Other DBs
NCBI-ProteinID: AFG36476
UniProt: H9UG33
Position
complement(453098..454168)
Genome map
AA seq 356 aa AA seqDB search
MSRCCTLSCCMMILFGCASSPSGPEVPPPRFTREDFLPLSQHAPAFPTTANELDAELFLA
YREFYGLAPGGSTHRVGWIPATQQQLFLQQWMPCAPAGPDSAGHPVPAILILHGYLEHAG
PMAPLINHLLGAGWPVASLDLPGHGLSGGERGWIGDFAEYADALEAAVAALQLPPEQPLV
LIGHSTGASAIIEYLYRDNGAVDLAILLAPLVRSSQWNLSRVGMTLSGPLPLRRIAGSPQ
SGTENPYYLQLAELDPLRSQHVNLEWVRALLRWDERNRGYPPLEVPALVIQACKDRVLDN
AYNDSYLRERLPQARFRRIRRAHHNLHHEQGVNLRLLLQAVEAAITATTGAVACED
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtccagatgctgcacgcttagctgttgtatgatgattcttttcggctgtgccagcagc
ccttccggtcccgaggttcctcccccgcgcttcacccgggaggattttctgccgctgagt
cagcacgcccccgcctttccgacaactgcaaatgaactggatgcagagctgtttctggcc
taccgggagttctacgggctggcgcccgggggcagcactcaccgcgtggggtggataccc
gccacacagcagcagctgttcctgcagcagtggatgccgtgcgcccctgccgggccggat
tcagcagggcaccccgtgccggcaatcctgatcctgcatggatatctcgaacatgccggc
ccgatggctccgctgatcaatcatttgctgggcgcaggctggccggttgccagccttgac
ctgccggggcatggcctgtccggcggagagcgcggctggattggtgatttcgccgagtat
gccgatgccctggaggcagcggtggccgcactgcagctgccgcccgagcagccgctggtg
ctcatcggacacagcaccggggcatcggccatcatcgagtacctctatcgggacaacgga
gccgtcgacctggcgattctgctggcaccgctggtgcgcagcagccagtggaacctgtca
cgtgtcgggatgaccctgagcgggcccttgccgctgcgccggatagccggctcgcctcag
tccggtaccgagaacccgtactatctgcagctggctgaactggaccccctgcgcagccag
cacgtcaacctggaatgggtgcgggccctgctgcgctgggatgaacgcaaccggggctat
cccccgctggaggtgcctgccctggtgatacaggcctgcaaggatcgtgtactggataat
gcctacaacgacagctatcttcgcgagcgtctgccgcaagcccgattccgacgcatccgc
agggctcaccacaacctgcatcatgaacagggcgtcaatctccggctgctgctccaggct
gtagaggccgcgattaccgcgactacaggtgcagtcgcttgcgaagattga

DBGET integrated database retrieval system