KEGG   Spirochaeta africana: Spiaf_0375Help
Entry
Spiaf_0375        CDS       T01811                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
sfc  Spirochaeta africana
Pathway
sfc00900  Terpenoid backbone biosynthesis
sfc01110  Biosynthesis of secondary metabolites
sfc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spiaf_0375
Enzymes [BR:sfc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     Spiaf_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AFG36480
UniProt: H9UG37
Position
complement(457227..458552)
Genome map
AA seq 441 aa AA seqDB search
MDYRLPADFRKLTIRERREMLARIYELTPQQLDGSGHEEELLDLADVMVESAAGFVPLPL
GVAGGVLIDGREYNIPMATEEPSVIAAATYGAKLIARSGGFTTSIDQPIMTAQVFLEDVP
ADRAAAVCGGASPDAPAAPKELDALLRSAIDTMLPGMTARGGGYRGCDAALLPETGLLRI
QLHIDVRDAMGANILNTAAEGVKPLLQEYCGGRGFMAILTNDAAYRHARAEFRMPLKSLR
RRGIDSSTLAERIVRASELAQEDSSRAVTHNKGIMNGVTALAIATGNDTRGLEAAVHRYA
ARDGRYRGISHYRIEDDALVGSIELPVPLGSVGGAIGFHPVADMAFRILDISSASELGRV
AAALGLAQNFAAVSALVSEGIQHGHMRFHAHRLAYQAGARDTEIAPVAAGITETGIFNLE
TANRVLQQLRSAGPGSSEAAE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggattatcgcctccccgcagattttcgaaagcttaccatacgcgagcggcgcgagatg
cttgcccgcatctacgaactgaccccgcagcagctcgatggcagcggccatgaagaggag
ctgctggatctggccgatgtcatggtggaatcagcagcagggtttgttcccctgccgctg
ggtgtagccggcggggtactgatcgatggccgggaatacaacatcccgatggcaaccgag
gagccctcggtaattgcggctgctacctacggcgccaaactgattgcccgttccggcggg
tttaccaccagcatcgaccagccgatcatgaccgcacaggtattcctggaggatgtgccg
gccgatcgtgccgcggctgtgtgcgggggggcttccccggatgccccggctgccccgaaa
gagcttgatgcactgctgcgcagcgccatcgacaccatgctgccgggcatgaccgctcgt
ggcgggggttatcgcggctgcgatgcagccctgctgcccgaaaccggcttgctgcggatc
cagctgcatattgatgttcgcgatgccatgggggccaacatactgaacaccgccgccgag
ggggtaaaaccgctgctgcaggagtactgcggcgggcgcggctttatggccatcctgacc
aacgatgccgcctaccgacacgcccgggcagagttccgcatgccgctgaaatccctgcgc
cgtcgggggattgacagcagcaccctggcagaacgcatcgtgcgggcatcggaactggca
caggaggactcatcccgggccgtaacccataacaaggggattatgaacggggtcaccgca
ctggcaattgcaaccggcaacgacacccgtggcctggaggctgccgtgcatcgctacgcc
gcccgcgacggtcgctatcgcggcatcagtcactaccggatcgaggacgatgccctggtc
ggcagcatcgagctgccggtcccgcttggcagcgttggcggggctatcgggtttcatccg
gtagcagatatggcattccggattctggacatttcctcggccagtgagcttggccgggta
gctgccgcactggggctggcgcaaaactttgccgccgtctcggccctggtatccgagggt
atccagcatgggcacatgcggtttcatgcccatcgactggcttatcaggccggggcacgc
gataccgagattgcgccggttgctgccgggattaccgaaaccgggattttcaacctggaa
acagccaaccgggtgctgcagcagctgcgttctgcaggaccagggtccagcgaggccgct
gaatga

DBGET integrated database retrieval system