KEGG   Spirochaeta africana: Spiaf_0394Help
Entry
Spiaf_0394        CDS       T01811                                 

Definition
(GenBank) flavodoxin
  KO
K00230  menaquinone-dependent protoporphyrinogen oxidase [EC:1.3.5.3]
Organism
sfc  Spirochaeta africana
Pathway
sfc00860  Porphyrin and chlorophyll metabolism
sfc01100  Metabolic pathways
sfc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Spiaf_0394
Enzymes [BR:sfc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.3  protoporphyrinogen IX dehydrogenase (menaquinone)
     Spiaf_0394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_5 Flavodoxin_1 Flavodoxin_3
Motif
Other DBs
NCBI-ProteinID: AFG36499
UniProt: H9UG56
Position
476201..476674
Genome map
AA seq 157 aa AA seqDB search
MRSLIVYATKYGAVEKAARLLADQLQGDVELVNLAAGPVADLTGIDRVIVGGSIYAGSIQ
EEVKQFCSSNQQQLLDRRFALFVCCGREDQAREQLAACLEPRLIQHAEQIGSFGYIYDFA
RMNLIFKLIIRKLAKVKTSQFNLREENIRTFAAQLNS
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagatccctgatagtctatgccaccaaatacggcgccgtcgaaaaggccgcccggctg
cttgccgatcagctgcagggcgatgtcgagctggtgaacctggcagcaggaccggtagcc
gatctgaccggtatcgaccgggtgattgttggcgggtccatctatgccgggagtatccag
gaggaggtcaagcagttctgcagcagcaatcaacagcagctgctggaccgtcgctttgcc
ctgtttgtatgctgcggtcgggaagaccaggcccgtgaacagctggcggcttgcctggaa
ccccggctgatacagcacgccgagcagatcggcagctttggctatatctatgactttgcc
aggatgaaccttatcttcaagctgatcatccgcaagctggccaaggtcaagacaagccag
ttcaacctgcgggaggaaaatatccgcacctttgcggcgcagctgaactcgtga

DBGET integrated database retrieval system