KEGG   Spirochaeta africana: Spiaf_0395Help
Entry
Spiaf_0395        CDS       T01811                                 

Definition
(GenBank) hypothetical protein
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VAPB_antitox HicB
Motif
Other DBs
NCBI-ProteinID: AFG36500
UniProt: H9UG57
Position
complement(476747..476998)
Genome map
AA seq 83 aa AA seqDB search
MSQITIRNLSPELDHLIRQEALKRHISLNEAVQHLLRQATGLDDNSDRKRDLRKLAGGWT
DENLHEFEQTQTINSAIDSELWQ
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaataacgattcgcaatctatctcccgaactcgatcatctcattcgacaggaa
gctctgaaacgacatatcagcctgaatgaggccgtgcagcatctgttgcgacaggcaaca
ggacttgacgacaacagtgaccgcaagcgtgatttgcggaaacttgccggaggatggaca
gacgagaatctgcatgagttcgagcaaacccagaccatcaattccgcaatagactctgag
ctctggcaatga

DBGET integrated database retrieval system