KEGG   Spirochaeta africana: Spiaf_0400Help
Entry
Spiaf_0400        CDS       T01811                                 

Definition
(GenBank) hypothetical protein
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFG36505
UniProt: H9UG62
Position
479944..480636
Genome map
AA seq 230 aa AA seqDB search
MNPEQDDVRRLEADIAVIKDSIRAKNGFVRRMLAAPVLGWFFVGFGAACAVVPLVWEYAL
RQYRGAEALPTQVTAALIAGTVVVFAVLAFWKIAAFNRGARAVDSRYSWLDVMRDLTSHP
VVLYQQVIMAGTAVAVVMAIRTGNAYLVPAALAAGLAMVFMLYAVAFLLNEYSFIIVWLS
LFAAAVLFLPGIPPLIMAAVGFGGGFLLYGIYSITMAPHPASSTHGGNQA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgaacaggatgacgtcagaagactggaagcggatatcgcggtaatcaaggat
tccatccgggcgaaaaacggatttgtccggcgaatgctcgccgctcccgtgttgggatgg
ttctttgtcggttttggtgctgcctgtgcggtggtacccctggtatgggaatatgccctg
cgtcagtaccggggggcagaggcgctcccgacacaggtcaccgccgccttgatcgccggt
acggtagtggtgtttgccgtacttgcattctggaaaatcgccgcctttaaccgtggcgca
cgcgccgtggacagtcgctactcatggctggatgtcatgagagacctcacgtcacatccg
gtggtgttgtatcagcaggtaatcatggctggaacagcggttgccgtggtcatggcgatc
cgcaccggcaacgcgtacctggtccccgcagcgctggcagccggcctggccatggtgttt
atgctgtatgccgtcgcctttttattgaatgaatattcattcattatagtctggctgtcc
ctctttgctgccgccgtactctttctgcccggcatccccccgctgatcatggccgctgta
ggattcggcggcgggttcctgctgtacggcatctacagcatcaccatggctccccacccc
gccagcagcacccacggaggtaaccaggcgtga

DBGET integrated database retrieval system