KEGG   Spirochaeta africana: Spiaf_0403Help
Entry
Spiaf_0403        CDS       T01811                                 

Definition
(GenBank) CRISPR-associated endonuclease Cas1
  KO
K15342  CRISP-associated protein Cas1
Organism
sfc  Spirochaeta africana
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfc03400]
    Spiaf_0403
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sfc02048]
    Spiaf_0403
DNA repair and recombination proteins [BR:sfc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factor
     Spiaf_0403
Prokaryotic defense system [BR:sfc02048]
 CRISPR-Cas system
  Universal Cas proteins
   Spiaf_0403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cas_Cas1
Motif
Other DBs
NCBI-ProteinID: AFG36508
UniProt: H9UG65
Position
482253..483212
Genome map
AA seq 319 aa AA seqDB search
MEYLNNLKAILHSKRANIFYLEKCRVLMKDGRVVYLTETKKENQYFNIPVANTTVILLGM
GTSITQAAVRMLASAGVLLGFSGTGGTPLLMGAEVEWMTPQSEYRPTEYVQGWLSFWFDE
RKRLSVAKRFQEARIEYLVKVWGKDRDLQDHQFFCDEDDIQRSLEAFRKEISGANSVESL
LSSEAQLTKRLYKAAAKRTGHGKFIREREAIDSANTFLNHGNYLAYGLAATCLWVLGIPH
GFAVLHGKTRRGALVFDVADIIKDAIILPWAFICAQDKLKGQEFRQHCLIQFTKHRALEH
VFELVKDVAISKGNMEEQV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaatatttgaataatctgaaagcgattctccactccaaacgtgcgaatatcttttac
ctggaaaaatgtcgtgttttaatgaaagacggccgggttgtatatcttaccgagacaaaa
aaagaaaatcagtattttaatattccagttgcgaatacgacggttattttgctcggcatg
ggaacttcgataacccaggctgcggtaagaatgctcgcttcggcaggcgtcttacttggc
ttctccggcaccggagggacacctttgctgatgggggcagaggttgaatggatgactccg
caaagtgagtatcgtccgacagaatatgtacaaggatggttgtccttttggtttgatgaa
aggaaacgtctctcggttgcaaaacgctttcaagaagcaagaatcgagtatcttgtaaag
gtgtgggggaaggatagagatcttcaggaccatcagtttttctgcgatgaggatgatatc
cagcgctccctggaagcgtttcgcaaggagatttctggtgctaactctgtagaatcatta
ttgagtagcgaagctcaattaacaaagcgcctgtacaaagcagcggcgaagcgaactggc
catgggaaatttattcgtgaacgtgaggcaatagacagcgcaaatacctttcttaatcac
ggaaattatctggcgtacggacttgctgcgacatgtctgtgggttcttggaattccacat
ggctttgcagttctgcatggaaaaacccgacgtggggctctggtttttgatgtggcggat
atcatcaaggatgcgatcattttgccatgggcctttatctgtgcacaggataaattaaag
gggcaggagttccgtcagcattgtctgatacagttcaccaagcatagggccctagagcat
gtatttgaactggtaaaggatgttgcaatcagcaagggtaacatggaagagcaggtatga

DBGET integrated database retrieval system