KEGG   Spirochaeta africana: Spiaf_0406Help
Entry
Spiaf_0406        CDS       T01811                                 

Definition
(GenBank) CRISPR type I-F/YPEST-associated protein Csy2
  KO
K19128  CRISPR-associated protein Csy2
Organism
sfc  Spirochaeta africana
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sfc02048]
    Spiaf_0406
Prokaryotic defense system [BR:sfc02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Subtype I-F factors
    Spiaf_0406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cas_Csy2
Motif
Other DBs
NCBI-ProteinID: AFG36511
UniProt: H9UG68
Position
487858..488745
Genome map
AA seq 295 aa AA seqDB search
MKRLLIIPHLIVQNANAQSSPYTLGFPAMTAFLGATHAFQRILSKQYPEFQVKSTGVVCH
NMELRTHKGYGDFVHSVINTANPITKDGKRPSFIEEPKCSLDITLIMEVDGMPLGSEEHK
FQKTASEVLDSKMRIAGGDILAYQPMIYQSVDSEDPVTLSRFKRLLMPGYVLVERRDLMI
QEMQDGNDALDALLNCMKIDHSCEQSEDGTVEWQSKRKYPGWLVPVAVGYQGVSELGRVS
RQRDPTVQHRFAEAIVTLGEFVMPYRLKKVDSLLWHYESDQEKGLYFCTQTNNQK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggttgctaattatccctcacttaatagttcagaatgcgaacgcacagtcgagc
ccgtatacactcggattccctgccatgactgcctttcttggggctacccatgcttttcaa
cggattttgtcaaagcaatatcctgagttccaggtaaaatccacaggtgtagtatgtcac
aatatggaattgcgtactcacaagggatatggagatttcgttcattcggtaatcaatact
gccaatccgataacgaaggatggcaagcggccttcctttatcgaagagccaaaatgttct
ctggatattaccctgattatggaagtagatggtatgccattggggagtgaagagcacaaa
ttccagaaaactgcttcggaggttctcgattcaaaaatgcgcattgctggcggtgatatt
cttgcatatcagccgatgatatatcaatcggttgattcggaggatccggtgacactttcc
aggttcaagcgattgttaatgccggggtatgtattggttgaacgtcgagacctcatgatc
caggaaatgcaggatggaaatgatgccttggatgcgctgttgaattgcatgaagatagat
cattcttgtgagcaatctgaagacggaaccgtggaatggcaaagtaaacggaaatatccc
gggtggcttgttcctgtagctgttggctaccagggtgtgtctgagcttggaagggtgagc
cggcagcgagatccaacagtacaacatcgctttgcggaggcaatagtcacactcggagaa
ttcgttatgccatacagattgaaaaaggttgatagtctgttgtggcattacgaatctgat
caggaaaaaggtttatatttctgtacacaaacaaataaccaaaaatag

DBGET integrated database retrieval system