KEGG   Spirochaeta africana: Spiaf_0408Help
Entry
Spiaf_0408        CDS       T01811                                 

Definition
(GenBank) CRISPR-associated protein Cas6/Csy4, subtype I-F/YPEST
  KO
K19130  CRISPR-associated endonuclease Csy4 [EC:3.1.-.-]
Organism
sfc  Spirochaeta africana
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:sfc02048]
    Spiaf_0408
Enzymes [BR:sfc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Spiaf_0408
Prokaryotic defense system [BR:sfc02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Subtype I-F factors
    Spiaf_0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cas_Csy4
Motif
Other DBs
NCBI-ProteinID: AFG36513
UniProt: H9UG70
Position
489796..490377
Genome map
AA seq 193 aa AA seqDB search
MNYYSEITLLPGADIGLYQLWSKVFTQVHLRLVEFQNPDGNVPIGVDWPEYKADIPSLGT
KLRIFSSTRETLEQFDLNVVLLRFSDYVKVSGIRSVPQNISSYVAYERVQKKQNPDRIAR
RRARRSNLDYTEALRAVAEKNAPVITLPYVQLISLSTKRKYSLFLAKRLTEEPGGNISFN
SFGINKHSTVPSF
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaattattactcagaaataacattgctgcccggtgctgacattgggttgtaccagtta
tggagcaaggtttttactcaggtgcatttgcggcttgtggaattccagaaccctgatggt
aatgtgccgataggtgttgattggccagagtacaaagctgatattccgtctcttggaact
aaactacgaatcttttccagcaccagggagacgttggagcagtttgacttgaatgtcgtt
cttctccgcttttcggattatgtaaaggtgagtggcatacgatcagtaccacagaacatc
agctcgtacgttgcctatgaacgtgttcagaaaaagcaaaaccctgacagaatcgcgaga
cgacgtgcccgaagaagcaaccttgactatacggaagctctaagagcagtggcagaaaaa
aatgccccagttattactctaccatatgttcaactgattagtctgagcaccaagagaaag
tactctctttttctggccaaacgccttactgaagaacccgggggaaatatttcgtttaat
tcatttggcattaataaacattccactgtcccctctttctga

DBGET integrated database retrieval system