KEGG   Spirochaeta africana: Spiaf_0410Help
Entry
Spiaf_0410        CDS       T01811                                 

Definition
(GenBank) aspartate/tyrosine/aromatic aminotransferase
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AFG36515
UniProt: H9UG72
Position
494734..496041
Genome map
AA seq 435 aa AA seqDB search
MRRQILHAGAGQLRYMIREIVQIAREIERLGQPVLWENIGDPVRKGESPPDWIKQLVGQA
ATEDMSYAYSDTQGEAATRGFLAERANGRLDGEAAGARITPDDILFFNGLGDAVSKLFGQ
LRPQARVIGPSPAYSTHSSAEAAHSGYEHLTYQLDPENGWLPDLQELENTIHYNPTIAGI
LIINPDNPTGVVYPRHILEGFVAIARRYNLFLICDETYAHVVYGGAQEVHLNQIIGDVPG
IAMRSISKEFPWPGARCGWIEVYNRTADADFAGYVESILAAKRLEVCSTTLPQRVIPLVM
GDARYAGHLGQRNREYESRAGEVCAALSGIPGVRVNRPQGGFFATPVFDPAMLPAAGRLE
IANPGIRRLVEQRLPGAAADARFVYWLLGSTGICTVPLSGFCSRLPGFRMTLLESDPEVR
AGMLDRLAAAIRSYG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagacagatactgcacgcaggggcggggcagcttcgctacatgatacgcgagatt
gtgcagattgcccgggagatcgagcggctgggccagccggttttgtgggagaacatcggg
gatccggttcgcaagggcgagtcaccgccggactggatcaagcagctggtggggcaggcg
gcgaccgaggatatgtcctacgcttactcggatacgcagggagaggcggctacgcggggg
tttctggccgagcgtgccaacggcaggctggacggggaagctgccggcgcgcggattacc
ccggatgacatcctgttctttaacggcctgggggatgcggtgtccaagctgttcgggcag
ctgcggccgcaggcgcgggtgatcgggccgagtccggcgtactcgacgcattccagtgcg
gaggcggcccactcgggctacgagcatttgacctatcagctggatccggagaacggctgg
ctaccggatctgcaggagctggagaatacgatccattacaatccgacgatcgcgggtatt
ctgattatcaacccggataatccgaccggggtggtgtatccgcggcatatcctggagggg
tttgtggcgatcgcccggcgctacaatctgtttctgatctgcgacgagacctatgcccat
gtggtgtacggcggggcgcaggaggttcacctgaatcagatcatcggggatgtgccgggg
attgcaatgcgcagcatctccaaggaattcccgtggcccggggcgcgctgcggctggatc
gaggtgtacaaccgtaccgcggatgcggattttgcggggtatgtcgagagtatcctggcg
gccaagcgtctggaggtgtgttctaccaccctgccgcagcgggtaattccgctggtgatg
ggtgatgcgcgctatgccgggcatctgggacagcgcaaccgggagtacgaatcgcgggcg
ggggaggtgtgtgcggcgttgtcgggtattccgggggtccgggtgaaccgcccgcagggg
ggattctttgcgactccggtgttcgatccggcgatgctgccggcggcggggcgtctggag
attgccaatccggggatccggcgcctggtggagcagcgactgccgggggcggcggcggat
gcgcggtttgtgtactggctcctgggcagtaccgggatctgtacggtgccgctgtcgggg
ttctgcagccggctgccggggttccggatgaccctgctggagagcgaccccgaggtgcgc
gcggggatgctggacaggcttgcggcggcgatccgcagctatgggtag

DBGET integrated database retrieval system