KEGG   Spirochaeta africana: Spiaf_0411Help
Entry
Spiaf_0411        CDS       T01811                                 

Definition
(GenBank) transcriptional regulator
  KO
K02529  LacI family transcriptional regulator
Organism
sfc  Spirochaeta africana
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sfc03000]
    Spiaf_0411
Transcription factors [BR:sfc03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    Spiaf_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 LacI Peripla_BP_4 Peripla_BP_1 HTH_24 HTH_Crp_2 HTH_Tnp_ISL3 Trp_repressor HTH_3 HTH_10 HTH_11 HTH_19 AalphaY_MDB HTH_35
Motif
Other DBs
NCBI-ProteinID: AFG36516
UniProt: H9UG73
Position
complement(496076..497083)
Genome map
AA seq 335 aa AA seqDB search
MSKKQTARKKSVTMQDIANETGVSITTVSHVINKTRHVNSETRSLVLDAMNRLEYSTRKT
RKRPAAAEGILGVIVADIREDYYVALVKAIETIASENGLSILLCDSEMDPEKEEKNIHTI
LERDVSGMIIAPIDSRTFPRELRETSLPVVLVDRQYDEHNRTFVGINNFESSVMAYRHLQ
NKGCSRIGFIGYSEHVYTVRKRIIGYKASVVETTPAYQPQVLKLHYDKEDSFSRIARFIT
EHDFDGLICATSDLCYETISALHETHIRIPEDIQVITYDDNKWLDYLKYPVSVVSQPTAE
IGAYAVEKLIQYIESPEDDPRIKTEVFFEVSIIDR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagcagactgcgcgaaaaaaatccgtgaccatgcaggacatagccaacgaa
accggcgtgtccattacaaccgtctcgcatgtcataaataaaacccgccacgtgaacagc
gagacccggtcgctggtattggacgccatgaatcgcctggaatacagcaccagaaaaacc
agaaaacgccccgccgctgccgaaggtatactcggtgttatcgtggccgacatccgcgaa
gactattacgtggcgctggtaaaggccatcgagaccattgcctccgagaacggcctgtct
atcctgttgtgtgactcggaaatggacccggaaaaagaagagaagaacatccatactatc
ctggaacgcgatgtttccggcatgattatcgccccgatcgactcccgcaccttccctcgt
gaactgcgtgaaacctctctcccggtggtactggtggaccggcagtacgacgaacacaac
cgcacctttgtcggtatcaacaactttgaaagcagcgtgatggcctatcggcatctgcag
aacaaaggctgcagccgcatcggcttcattggatattccgagcatgtctacaccgtgcgc
aaacggatcatcggctacaaagccagcgtggtagaaaccaccccggcctatcagccccag
gtgctcaagctgcactacgacaaggaagactcattctcgcgcattgcccgctttattacc
gaacacgacttcgacggcctgatttgcgcaacatccgacctctgctacgaaaccatcagc
gccctgcacgaaacccacatccgcattcccgaggacattcaggtaataacctacgacgac
aacaagtggctcgattacctgaaataccccgtctcggtggtgagtcagcccaccgccgag
atcggtgcctacgccgtcgagaaactcatccagtacatcgagtcgcccgaggacgacccg
cgcatcaaaaccgaggtgtttttcgaggtgagtataattgatcgttga

DBGET integrated database retrieval system