KEGG   Spirochaeta africana: Spiaf_0412Help
Entry
Spiaf_0412        CDS       T01811                                 

Definition
(GenBank) ABC-type sugar transport system, ATPase component
  KO
K17215  inositol transport system ATP-binding protein
Organism
sfc  Spirochaeta africana
Pathway
sfc02010  ABC transporters
Module
sfc_M00593  Inositol transport system
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Spiaf_0412
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfc02000]
    Spiaf_0412
Transporters [BR:sfc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Inositol transporter [MD:M00593] [OT]
    Spiaf_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA_29 Zeta_toxin AAA_23 AAA_15 AAA_22 AAA_30 AAA_27 G-alpha
Motif
Other DBs
NCBI-ProteinID: AFG36517
UniProt: H9UG74
Position
497233..498765
Genome map
AA seq 510 aa AA seqDB search
MTETHMEKQGSDYLLEVQGISKSFPGVKALDSIHFRLRPGTVHVLCGENGAGKSTFLKIM
NGLHQPDQGEIRVHGEAVQIRHPLQARRLGIGMIFQELDYVPNFTVEQSLFLGEEPRNAI
GGVNWKQIRRRTVELLQAEGLPYKPTTRLKDLTVSDIQMLEILKAVSSDTRILLMDEPTS
AITDKEIDMLFAKIRQLRDKGVGIVYISHKLDEIFRIADEITVFRDGQHVGNAPAAELDK
DRVIAMMVGRRLENIFPDKPSIEPGGVALELRNLSRGRVFQDVSLQLRAGEVVGMAGLVG
AGRTEIARAIFGLDPYDSGEVLVHDVAPQRRNDVAAAISSGVAMLSEDRKRYGLVLSRSV
KENASLLVLRKYFARWWNNARAENRDVRAVFKTLNVKTSSLSTIAGTLSGGNQQKVVLTK
WLLKDQDVVILDEPTRGIDVGAKYEIYKIILELAAKGKAVLVISSELPELIGICDRLYVV
AKGRITKELKRDEFSQETIMKYAAQGEADE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaacacatatggaaaaacagggttcggactatctgctggaggttcagggtatc
tccaagtcgtttcccggggtcaaggcgcttgattcgattcatttccggctgcggccggga
acggtgcatgttctgtgcggcgagaacggggcgggtaaatccacctttctcaagataatg
aacgggctgcatcagccggatcagggtgagatacgggttcatggcgaggcggtgcagata
cgccatccacttcaggccaggcgtctgggcatcgggatgatttttcaggagctggactat
gtaccgaattttacggtggaacagagcctgtttctgggagaggagccccgcaatgcgatt
ggcggggtgaactggaagcagattcgccgtcgtaccgtggagctgctgcaggccgagggt
ttgccgtataaaccgaccactcgcctgaaggacctgacggtttctgatatccagatgctg
gagatcctgaaggcggtgtccagtgatacccgcatcctgcttatggatgaaccgacctcg
gcaatcaccgacaaagagatcgatatgctgtttgccaagatccgtcagctgcgcgacaag
ggggtcggcattgtctatatctcccacaagctcgacgagattttccggattgccgacgag
attacggtgtttcgcgatgggcagcatgtgggcaacgccccggcagccgagctggacaag
gatcgggtgattgcaatgatggtcggccggcggctggagaatatcttcccggacaagccg
tcgatagagccgggcggggttgcgcttgagctgcgcaacctgagcagaggacgggtgttc
caggatgtttctctacagctgcgagccggtgaggttgtcggtatggcggggctggtgggt
gccgggcgaaccgagattgcgcgggcgattttcgggctggatccctacgacagcggcgag
gtgctggtgcatgatgttgcgccccaacgaagaaacgatgtggcggcggcgatatcgagc
ggggttgccatgttgtcggaagacagaaagcgatacggcctggtgctgtctcgcagcgta
aaggaaaacgcatcgctgctggtgctgcgaaaatactttgcccgctggtggaataatgcc
cgggccgagaaccgggatgtacgggcggtgttcaagaccttgaatgtaaagacatcctcc
ctgtccaccattgccggcaccctgagcggcgggaatcagcagaaggtggtgcttaccaaa
tggctgctgaaggatcaggatgtggtaatcctggatgaacctacccgcggtatcgacgtt
ggtgccaagtacgagatctacaaaattatcctggagctcgccgccaagggtaaggcggtg
ctggttatctcttccgagctgccggagctgatcggtatatgtgatcggctgtatgtcgtg
gccaaggggcggattaccaaagagctgaagcgggacgagttcagtcaggagacaatcatg
aagtatgcagcgcaaggagaggcagatgaataa

DBGET integrated database retrieval system