KEGG   Spirochaeta africana: Spiaf_0419Help
Entry
Spiaf_0419        CDS       T01811                                 

Definition
(GenBank) 7-cyano-7-deazaguanine reductase
  KO
K09457  7-cyano-7-deazaguanine reductase [EC:1.7.1.13]
Organism
sfc  Spirochaeta africana
Pathway
sfc00790  Folate biosynthesis
sfc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Spiaf_0419
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sfc03016]
    Spiaf_0419
Enzymes [BR:sfc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.13  preQ1 synthase
     Spiaf_0419
Transfer RNA biogenesis [BR:sfc03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Spiaf_0419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QueF QueF_N
Motif
Other DBs
NCBI-ProteinID: AFG36524
UniProt: H1NB75
Position
complement(505360..505839)
Genome map
AA seq 159 aa AA seqDB search
MRDDLQNLGLGGKTTYPVEYDPTVLESFENRHQHRDYFVKFNCPEFTSLCPITNQPDFAT
IYLQYIPDKRMVESKSLKLYLFSFRNSGEFHEDCVNRILDDLVALLEPRYLEVWGKFTPR
GGISIDPYANYGQPDTAWQDFAAQRLLMHDLYPEKIDNR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacgatctgcagaacctggggctgggtggaaaaaccacctaccccgtcgaatac
gaccccaccgtgctggagagctttgaaaaccggcaccagcaccgggactacttcgttaaa
ttcaactgtcccgagtttaccagtctctgccctatcaccaatcaacccgacttcgcgacc
atctacctgcagtacatccccgacaagcgtatggtcgagagcaaatcccttaaactgtac
ctgttcagctttcgcaatagcggtgaattccacgaggactgcgtcaatcgcatcctcgac
gacctggttgccctgcttgaaccgcgctacctggaggtctggggcaagttcaccccgcgc
gggggaatcagcatcgacccctacgccaactacggacagcccgacaccgcgtggcaggac
ttcgctgcccagcgcctgctgatgcacgatctgtacccggaaaagatcgacaaccgctga

DBGET integrated database retrieval system