KEGG   Spirochaeta africana: Spiaf_0435Help
Entry
Spiaf_0435        CDS       T01811                                 

Definition
(GenBank) putative nucleic acid-binding protein, contains PIN domain
  KO
K18828  tRNA(fMet)-specific endonuclease VapC [EC:3.1.-.-]
Organism
sfc  Spirochaeta africana
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sfc03016]
    Spiaf_0435
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:sfc02048]
    Spiaf_0435
Enzymes [BR:sfc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Spiaf_0435
Transfer RNA biogenesis [BR:sfc03016]
 Prokaryotic Type
  tRNA degradation factors
   Spiaf_0435
Prokaryotic defense system [BR:sfc02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   VapC-VapB
    Spiaf_0435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIN
Motif
Other DBs
NCBI-ProteinID: AFG36539
UniProt: H9UG96
Position
519326..519721
Genome map
AA seq 131 aa AA seqDB search
MSRVMLDTNAYTALMAGDTRIADLLARSEAVLLSPVILGELYDGFLNGNRNLENRRILGR
FLDKPRTLCPPITDTTAEWFAEIKRSLRRRGTPIPINDVWIAASCMEHGARLLTFDAHFA
VVDGLLRCELR
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgagccgggtaatgctggataccaatgcctataccgccttgatggctggcgacactcgt
attgccgatctgttagctcgaagcgaggcagttttgctctcaccagtcattttgggcgag
ctctacgatggatttctgaatggaaaccgtaatctggaaaaccgtcgtattcttggccgt
tttctcgataaaccacgcaccctctgcccgccgataaccgacaccaccgccgaatggttt
gccgaaatcaagcgcagcctgcgccgccgcggcacccccatccccatcaatgacgtctgg
attgccgcctcctgtatggaacacggcgcccgcctgctcacattcgatgcacactttgcg
gtggtcgacgggctgctgcgctgtgaactgaggtaa

DBGET integrated database retrieval system