KEGG   Spirochaeta africana: Spiaf_0436Help
Entry
Spiaf_0436        CDS       T01811                                 

Definition
(GenBank) hypothetical protein
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF86 Aminotran_4 NTase_sub_bind
Motif
Other DBs
NCBI-ProteinID: AFG36540
UniProt: H9UG97
Position
complement(519730..520206)
Genome map
AA seq 158 aa AA seqDB search
MADLSTAPVTLQSAVRECDSHMQRLDRSSELLAGFFPLTRTALEQADDQQIEHIDQFIYR
FMKLQDSLGTRLLPSLYAILEQSTQPRPFLDILNRLEQLEVIPSAADWQFFRNLRNNLAH
DYPESIDQTVLTLNTLHSHWPRLREFYQQARAAAVRVR
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctttccaccgctccggtaaccctgcagtcggcagtccgggaatgtgacagc
cacatgcaacggctggatcgcagcagtgagctgctggccgggttctttccccttacccga
actgcccttgagcaggctgatgaccagcagattgagcatatcgatcagtttatctatcgt
ttcatgaagctgcaggactcgcttggcacccggctgctgccttcgttgtacgccatactg
gagcaaagcacccagccgaggccgttcctggatatcctgaaccgtctggaacagcttgag
gttattccctctgccgctgactggcagttttttcgcaatctgcgcaacaatctggcccac
gactaccccgagtcaatcgaccagaccgtgctgaccctgaacacgctgcacagccactgg
ccgcggctgcgggagttctaccagcaggcgcgcgcggctgcggtgcgggtgcggtaa

DBGET integrated database retrieval system