KEGG   Spirochaeta africana: Spiaf_0438Help
Entry
Spiaf_0438        CDS       T01811                                 

Definition
(GenBank) putative nucleic acid-binding protein, contains PIN domain
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIN DUF374
Motif
Other DBs
NCBI-ProteinID: AFG36542
UniProt: H9UG99
Position
complement(520624..521046)
Genome map
AA seq 140 aa AA seqDB search
MFVLDTNVLSELMRANPDPGVMQRIGSLPPAHTFITTITSAEILYGLDEMPEGERKILLI
SAAAELLHSDFSGRILSFDTPAAVEYASIVGTRRRSGRPIAMADAIIAAICRSRDAELLT
RNTRDFGATGIRLSNPFIAE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgctggatacgaatgtgctctcggaactgatgcgcgccaatcccgatccgggg
gttatgcagcggattggctcactgccacccgcacacacctttattaccaccattacctcc
gccgagattttatatgggctggatgaaatgccagagggagaacgcaagattctgctgata
tctgctgctgccgagctgctgcacagcgatttttccgggcgcatactgagctttgatact
cccgcagcggttgagtatgcctcaatcgtgggaactcgccggcgatccggccgaccgata
gcaatggcagatgcgatcatagcggctatttgccggagtcgtgatgcagaactgctgaca
cgcaatacccgcgattttggggctaccgggatcaggctgtcgaatccgtttattgcagaa
tag

DBGET integrated database retrieval system