KEGG   Spirochaeta africana: Spiaf_0439Help
Entry
Spiaf_0439        CDS       T01811                                 

Definition
(GenBank) hypothetical protein
  KO
K21495  antitoxin FitA
Organism
sfc  Spirochaeta africana
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sfc02048]
    Spiaf_0439
Prokaryotic defense system [BR:sfc02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   FitB-FitA
    Spiaf_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arc GvpL_GvpF DUF1582 DUF4727
Motif
Other DBs
NCBI-ProteinID: AFG36543
UniProt: H9UGA0
Position
complement(521048..521290)
Genome map
AA seq 80 aa AA seqDB search
MATLTIRNLDARVKQQLRRRAAEHQNSMEEEVRQILSDVLSREPSPEENLAERIHTRFAA
VGGIDLPPPDRTDLPREPGF
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atggcgacattgactattcgcaatctcgatgcccgggtaaaacagcagctcaggcggcgg
gcagccgagcatcagaattcgatggaggaagaggttcgtcagattctgtccgatgtcctg
tcgagagaaccctcaccggaagaaaatctcgccgaacgcattcacaccaggtttgccgct
gttggcggcatagacctcccccctcctgatcgtaccgatctgccgcgtgagccggggttc
tga

DBGET integrated database retrieval system