KEGG   Spirochaeta africana: Spiaf_0440Help
Entry
Spiaf_0440        CDS       T01811                                 

Definition
(GenBank) putative tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase with PP-loop ATPase domain
  KO
K00566  tRNA-uridine 2-sulfurtransferase [EC:2.8.1.13]
Organism
sfc  Spirochaeta africana
Pathway
sfc04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Spiaf_0440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sfc03016]
    Spiaf_0440
Enzymes [BR:sfc01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.13  tRNA-uridine 2-sulfurtransferase
     Spiaf_0440
Transfer RNA biogenesis [BR:sfc03016]
 Prokaryotic Type
  tRNA modification factors
   Thiolation factors
    Spiaf_0440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_Me_trans Asn_synthase QueC ThiI Diphthami_syn_2
Motif
Other DBs
NCBI-ProteinID: AFG36544
UniProt: H9UGA1
Position
521358..522752
Genome map
AA seq 464 aa AA seqDB search
MYSGDANPAAPFISAPDSGTIAAMKIAVLLSGGVDSSVALNLLLRQGYTDITAYYLKIWL
EDEMAYMGSCPWEEDLQYAEAVCDQAGVPLKVLPLQQQYYDRVVSYAIDELRAGRTPSPD
IFCNQRIKFGAFWDELQEHYDYVATGHYARIDRLPPGSPLPPFLAGFGETTPGGASPSAG
EAATRRAPHGGQGSAIPREPSAAGAADQPLCLLRRAPDPVKDQSYFLSHLSQDQLQKILF
PLGEYTKAQVRAFAQEFDLPTKDRKDSQGICFLGKIRYPEFVGHYLGEQDGPLVERETGT
ELGRHKGYWYFTIGQRQGIGLGNGPWYVVGKDVAQNIVYISHSSHRDEAKRSSFRIENMS
WTVPAPDMAGFAAGGWGRQADESGADDAAGVADMPAASGNYPLLTKLRHGPELTPCSLNP
DTGLVQLQGGDQGVAPGQFSVLYAGEYCLGGGRICADEVSTGQG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgtattccggcgacgcgaatcccgccgccccctttatctccgcccccgattccggcaca
atagccgccatgaagattgccgtgctcctgtccggcggggtggacagctccgtcgcgctc
aacctgctgctgcggcagggctacaccgacatcaccgcctactacctcaagatctggctc
gaggacgagatggcctacatgggctcttgcccctgggaagaggatctgcagtacgccgaa
gcggtctgcgatcaggccggcgtccctctcaaggttctgcccctgcagcagcagtactac
gaccgcgtcgtctcctacgccatcgacgagctgcgcgccgggcgcacccccagccccgac
atcttctgcaaccagcgcatcaagttcggcgccttctgggacgagctgcaggagcactac
gattacgtcgccaccggccactacgcccgcatcgaccggcttccacccggcagccccctg
ccgccgtttctggcaggcttcggagagaccactccggggggcgccagcccatcggccggc
gaggccgcgacccgacgcgccccccatggcggacaaggttccgccattccccgggagccc
tcagcggccggtgctgccgaccagcccctctgcctgctgcggcgagcaccggatccggtc
aaggatcagagctactttttaagccacctctcgcaggatcagctgcagaaaatcctgttt
cccctgggtgagtataccaaagctcaggtgcgcgcgtttgcacaggagtttgatctgcct
accaaggaccgcaaagacagtcagggtatctgctttctgggcaagatccgctaccccgag
ttcgtcgggcattatctgggcgagcaggatggcccgcttgttgagcgcgagaccggcacc
gagctggggcgccacaagggctactggtactttaccatcgggcagcgccagggcatcggg
ctgggcaacggtccctggtacgtggtcggcaaggacgttgcgcagaatatcgtctacatc
tcgcacagcagtcaccgcgacgaggccaaacgcagcagcttccgcatcgagaacatgagc
tggaccgtacccgcgcccgatatggcagggtttgcggctggcgggtgggggagacaggct
gacgaatccggtgcagacgatgcagctggcgtcgccgacatgcctgcggcctccggcaac
tatcccctgctgaccaaactgcgccacggccccgagctgaccccctgcagtctcaacccc
gacaccggtctggtgcagctgcaaggcggcgaccagggagtggccccggggcagttctcg
gtactctatgccggagagtactgcctgggcggcgggcgcatctgtgctgatgaggtgagt
accgggcagggataa

DBGET integrated database retrieval system