KEGG   Spirochaeta africana: Spiaf_0442Help
Entry
Spiaf_0442        CDS       T01811                                 

Definition
(GenBank) putative nucleic acid-binding protein, contains PIN domain
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIN
Motif
Other DBs
NCBI-ProteinID: AFG36545
UniProt: H9UGA2
Position
complement(523525..523929)
Genome map
AA seq 134 aa AA seqDB search
MYLIDTSAWIAHFSSSYPFRLSDICSPDEHYICLPVYQEILQGIRDDAQFTRIQHILDAS
QWVGSPLKHTTFQSAAQLYRTARRQGLTVRSSTDCLIAALGLEHNLTILHHDRDYEQLAG
ISLLQQRCIMLHHQ
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgtatctgattgacacatcggcatggattgctcatttcagcagcagctacccatttcga
ctgagcgatatatgctccccggatgaacattatatctgcttaccggtgtatcaggagata
ctacagggaattcgggatgacgcccagtttactcgcattcagcacatcctcgatgccagc
cagtgggtaggaagcccgctgaagcacaccaccttccaatcagccgcccagttataccgc
acagcacgccgacagggactaacggtgcgatcttccacagattgcctgatcgcagcactt
ggactcgaacacaatcttaccatactccaccatgaccgtgattacgaacagcttgccggg
atatccttgctgcaacaacgctgtatcatgctacatcatcagtaa

DBGET integrated database retrieval system