KEGG   Spirochaeta africana: Spiaf_0443Help
Entry
Spiaf_0443        CDS       T01811                                 

Definition
(GenBank) hypothetical protein
Organism
sfc  Spirochaeta africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VapB_antitoxin CcdA
Motif
Other DBs
NCBI-ProteinID: AFG36546
UniProt: H9UGA3
Position
complement(523916..524125)
Genome map
AA seq 69 aa AA seqDB search
MKRTNLVLDEDLLNDARAISGARTYSEAVNLALRELVRRRTYQQVDKLANSDIWSGNLSE
MREDAHVSD
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcacaaatcttgtgttggatgaagatctgctgaatgatgctcgcgcgatttcc
ggtgctcgcacctactcggaagccgtgaacctcgcacttcgggaactcgttcgtcggcgc
acctaccagcaggttgacaagcttgccaatagtgacatctggtcaggcaatctttcagaa
atgcgggaagatgcgcatgtatctgattga

DBGET integrated database retrieval system