KEGG   Spirochaeta africana: Spiaf_0444Help
Entry
Spiaf_0444        CDS       T01811                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
sfc  Spirochaeta africana
Pathway
sfc00270  Cysteine and methionine metabolism
sfc00920  Sulfur metabolism
sfc01100  Metabolic pathways
sfc01110  Biosynthesis of secondary metabolites
sfc01130  Biosynthesis of antibiotics
sfc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Spiaf_0444
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Spiaf_0444
Enzymes [BR:sfc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Spiaf_0444
    2.3.1.46  homoserine O-succinyltransferase
     Spiaf_0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AFG36547
UniProt: H9UGA4
Position
524573..525502
Genome map
AA seq 309 aa AA seqDB search
MPIKILNALPAREHLERENIFVMTEDRAEHQDIRPLRIAIVNLMPTKIATETQLLRLLSN
TPLQVDIDLVHTTSHESKNTDPEHLERFYTSFEHIRQNRYDGMIITGAPVETIPFEDVDY
WDELAAIMDYSRSNVCSTLHICWGAQAGLYHHYGIEKYPLPEKLFGVYMHQRHDDHMPLF
RGFDEWFPVPHSRYTDIRLQDIQARPQLEILATAREAGAGIISAHEGRQIFITGHLEYDA
DTLAIEYQRDIEKGLEIGVPENYFPGEDPSRSPIATWRAHAHLLFVNWLNYYVYQATPFD
LADLPAIEG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaagattctgaacgcactgcctgcccgggaacacctggagcgcgagaacatc
ttcgtgatgaccgaggatcgtgccgagcaccaggatattcgcccgctgcggattgcgatc
gtcaacctgatgccgaccaagattgcaaccgagacgcagctgctgcggctgctcagtaac
acccccctgcaggtggatatcgatctggtgcataccacctcccacgaatcgaagaatacc
gatccggagcacctggaacgcttttatacctcgtttgagcatatccggcagaaccgctac
gatggtatgatcattaccggggcgccggtcgagacgattccttttgaggatgtcgattac
tgggacgagttggctgccattatggactacagtcgcagcaatgtctgttccaccctgcat
atctgctggggggctcaggccgggctgtatcatcactatggcatagagaagtacccgctg
ccggagaagctgttcggggtgtatatgcaccagcgccatgacgaccatatgccgctgttc
cgcgggtttgatgagtggtttccggtgccgcattcgcgctacaccgatatccgtctgcag
gatatccaggcacgcccgcagctggaaatcctggccaccgccagggaagcgggtgcgggg
atcatctcggcacacgagggccggcagatctttattaccggtcacctggagtacgatgcc
gataccctggcgatcgagtaccagcgcgacatcgagaaggggctagagatcggggtcccc
gagaactactttcccggggaggatccatcccgctctccgattgccacctggcgggcgcat
gcccatctgctgttcgtaaactggctgaactactatgtctaccaggccaccccgtttgat
cttgccgatctgccggcgattgaggggtag

DBGET integrated database retrieval system