KEGG   Spirochaeta africana: Spiaf_0445Help
Entry
Spiaf_0445        CDS       T01811                                 

Definition
(GenBank) tRNA-dihydrouridine synthase
  KO
K05539  tRNA-dihydrouridine synthase A [EC:1.-.-.-]
Organism
sfc  Spirochaeta africana
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sfc03016]
    Spiaf_0445
Enzymes [BR:sfc01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     Spiaf_0445
Transfer RNA biogenesis [BR:sfc03016]
 Prokaryotic Type
  tRNA modification factors
   Dihydorouridine synthases
    Spiaf_0445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dus
Motif
Other DBs
NCBI-ProteinID: AFG36548
UniProt: H9UGA5
Position
525506..526690
Genome map
AA seq 394 aa AA seqDB search
MHTADAAPAADGAAPADGSAAAPGSGYGREAVLPGSRRLPERPGFTSPYPVSVAPMMDRT
DKFFRWFLRQITPNTLLYSEMVSTGAIVHGDRERHLGFFPEEKPLALQLGGSDPAEVGEA
VRIAEDWDYDEVNLNVGCPSDRVQHRGIGACLMADPPRVAQLVEVMRANTRKPVTVKHRI
GIDGRESFEELCEFVDVVARAGVERLTVHARIAILEGLSPKDNRNVPPLRYEDVYRLKCE
FPELEIEINGHIGSVADIRGHLQQVDAVMLGRAAYDNPYLFADIEREIFGGAAGAAAAGA
AGGAMDAAGASGAGAGAGAVWQAPSRAEVIARTIEFLETRWRDDFPRAPLGHLMGLYHGM
PGARRWRGTISTELAAGTAPAEVLRRAQEVLPKI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccgcagatgcagcccccgccgccgatggtgccgcaccagccgatggcagcgca
gccgctccgggaagcggttacggccgggaggccgtactgccgggcagccggcgattgccg
gaacggcccggctttacttccccctatcccgtaagtgtggccccgatgatggatcgcacc
gacaaattctttcgctggtttttgcggcagattaccccgaacaccctgctgtacagcgag
atggtgagcaccggggcgattgtgcatggcgaccgcgagcggcatctgggtttttttccg
gaggagaagccgctggcgctgcagctggggggcagtgaccctgcagaggtgggcgaggcg
gtccggattgccgaggactgggactacgacgaggtgaacctgaatgtggggtgtccgagt
gatcgggtgcagcatcgcgggatcggggcctgtctgatggccgatccgccgcgggtggcg
cagctggtagaggtgatgcgggccaatacccgaaagccggttaccgtgaagcatcgcatc
gggatcgacgggcgcgagagcttcgaggagctgtgcgagtttgtggatgtggtggcgcgg
gccggggtggagcgattgacggtgcatgcgcggattgcgatcctggaggggttgagcccc
aaggataaccgcaatgtgccgccgctgcgctacgaggatgtgtaccggctcaagtgcgag
tttcccgagctggagatcgagattaacggccatatcggctcggtggcggatatccgcggg
catctgcagcaggtcgatgcggtgatgctggggcgggcggcctacgataatccctacttg
tttgcggatatcgagcgcgagatttttggcggggctgcgggtgccgcggcggccggggca
gccggcggtgcgatggacgcagcaggtgcttcaggggcgggcgcaggtgccggggcagtc
tggcaggcgccgtcgcgggccgaggtgattgcgcgcaccatcgagtttctggagacccgc
tggcgcgatgactttccgcgggcgccgctggggcatctgatggggctgtatcacgggatg
ccgggggcacggcgctggcgcgggacgatttccaccgagctggctgccgggacagcgccg
gccgaggtgctgcggcgggcacaggaagttttaccaaagatataa

DBGET integrated database retrieval system