KEGG   Spirochaeta africana: Spiaf_0447Help
Entry
Spiaf_0447        CDS       T01811                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sfc  Spirochaeta africana
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Spiaf_0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AFG36550
UniProt: H9UGA7
Position
complement(528266..529822)
Genome map
AA seq 518 aa AA seqDB search
MNRHYSARPGRIEYLRLLTSAIFILAVVSYTWLQHGYLSLSLVAAAAFGAYMALNIGAND
VANNVGPAVGARAMRLGTAVVIAAIFEAAGAIIAGGAVVSTIGSGIIQPEMLPDAEVFIW
LMMAALLGAALWLNIATAIGAPVSTTHSIVGGVLGAGIAAAGWEIANWSTVGRIVASWVI
SPLLGGIFAAIFLFIIKHSITYRRDMVTASRRTVPVLISLMGWAFTTYLLIKGLETIFPV
AFPQAAGIGLIAGAACFLLSRIRLKRTCTCMANDKESVNSLFALPLVFAAALLSFAHGSN
DVANAIGPLAAIYDSLLTNSISSGVEIPFWILGLGALGLAFGLALYGPKLIKTVGTEITD
MDNMRAYSIAMAAAVTVITASQLGLPVSTTHVTIGAVFGVGFLREHLKVTYKRIIAEIEA
HHEHTDAHPDEVETFLNSFEAASVTEKGRMLKELKQRRKHGQTEITKKERKKLRRVYREN
LVRRAIILRIAAAWIITVPGTAVLSGVIYFTIRGMLLP
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgacactacagcgcccgacccggccgtatcgagtacctgcgattactgacatcg
gccatctttattctggctgttgtcagctacacctggctgcagcatggctacctcagcctg
agcctggtagctgcggctgcctttggcgcctacatggccctgaacatcggtgccaacgat
gtagccaacaatgtcggcccggcggttggcgcccgggcgatgcgtctgggcacggcggtg
gtaatcgccgccatcttcgaggccgccggtgccatcatcgccgggggagcggtcgtcagc
accattggcagcggcatcatccagcccgagatgctgcccgatgccgaggtatttatctgg
ctgatgatggccgccctgctgggcgctgccctctggctgaacatcgccaccgctatcggc
gccccggtttccactacccactccatcgtcggcggggtgctgggcgccgggatcgcggcg
gctggctgggagatagccaactggagcacggttggtcggatcgtcgccagctgggttatc
tcgccgctgttaggcggaatttttgccgcgatcttcctgtttattatcaagcacagcatt
acctatcggcgtgacatggttactgcatcacggcgcaccgtcccggtgctgatcagcctg
atgggctgggcattcactacctatctgctgattaaaggcctggaaacaatcttcccggta
gcatttccccaggcagccggcatcggactgatcgccggcgcagcctgctttctgctcagt
cgcatccggctcaagcgcacctgtacctgcatggccaacgacaaggagtcggtcaacagc
ctgttcgccctgcccctggtctttgccgccgccctgctgagcttcgcccacggctcgaac
gatgttgccaacgctatcggcccccttgctgccatctacgacagcctgctgacgaacagc
atctcttccggcgtcgagatcccgttctggatactcgggctcggggccctggggctggca
ttcgggctggcactgtacggccccaagctcatcaaaaccgttggcaccgagatcaccgac
atggacaacatgcgcgcctacagcatcgccatggcggctgcggtcaccgtgattaccgcc
tcccagctgggactgccggtcagcaccacccacgtcaccatcggtgccgtattcggggtc
ggctttctgcgggaacacctgaaggttacctacaagcgaatcattgccgagatcgaggcg
caccacgaacataccgacgcccatcccgacgaggtagaaacctttctgaacagcttcgag
gccgcctcggtaaccgagaaggggcgcatgctcaaggaactcaagcagcggcgcaaacac
ggccaaaccgagatcaccaagaaggagcgcaagaaactgcgccgggtctaccgcgagaac
ctggtgcgccgggccatcatcctgcgaatcgctgcagcctggatcatcaccgtacccggg
actgcggttctgtccggtgtgatctactttaccattcgcggcatgctgttgccgtaa

DBGET integrated database retrieval system