KEGG   Spirochaeta africana: Spiaf_0449Help
Entry
Spiaf_0449        CDS       T01811                                 

Definition
(GenBank) alpha/beta hydrolase family protein
  KO
K01046  triacylglycerol lipase [EC:3.1.1.3]
Organism
sfc  Spirochaeta africana
Pathway
sfc00561  Glycerolipid metabolism
sfc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Spiaf_0449
Enzymes [BR:sfc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     Spiaf_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Palm_thioest Abhydrolase_1 PGAP1 DUF676 Lipase_2 LCAT DUF900
Motif
Other DBs
NCBI-ProteinID: AFG36552
UniProt: H9UGA9
Position
532702..533598
Genome map
AA seq 298 aa AA seqDB search
MKRIMHMLLAMLAVGFTGGCANDAQQTDIDRSQEQLANLQYPILLVDGLARRGDVGALAT
FDTALDHLQDLGAAVFMNSRDAFGSIESNAELLARDVDRVLQETGAEKLHIIAHSKGGLD
SRYLISNLGYHDRIATLVTIATPHRGTAVADYIEDNLGEAEEVVARAVNWFAGLLGDVTP
DAESAAHQLTTSYMQQFNRDVVNQPEVRYISYAAVIDSSYPNPIWARMARQLGETEGPND
GLVSVRSARWGEFRGVVNELYGVEQVSHRDVVGMNDIWNNMGFPHLRFITDVVLELER
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaataatgcatatgctgctggcgatgctggcggttggttttactggcggctgc
gccaatgatgcacagcagaccgacatcgaccgctcgcaggagcagcttgccaatctgcag
tacccgatactgctggtggatggattggcgcggcgtggtgatgtaggggcactggccacc
ttcgatacagccctggatcatctgcaggatctgggcgctgcggtgttcatgaactcccgg
gatgcatttggctctatcgaaagcaatgccgaactgcttgccagggatgtcgaccgggta
ctgcaggaaaccggtgccgaaaagctgcacattattgcccattccaagggcgggcttgat
tcccgctatctgatcagcaatctcggttatcatgaccggatcgccaccctggtgacaatt
gctacccctcatcggggtacggcggtagccgattacatcgaagacaatctgggagaagcc
gaagaggtggttgcccgtgccgttaactggtttgccggtctgctgggggatgttaccccc
gatgccgagtcggcagcccatcagctcaccaccagctacatgcagcagttcaaccgtgat
gtggtgaaccagccggaggttcgctacatcagctatgctgcggttatcgacagcagctat
ccgaacccgatctgggcgcggatggcccgccagctaggcgaaaccgaggggccgaatgac
ggcctggtgtcggtgcgttctgctcgctggggggagttccgcggggtagtgaacgaactc
tacggcgtggaacaggtgagccatcgggatgtcgtggggatgaacgatatctggaacaat
atgggattcccgcatctgcggtttattaccgacgtggtgctggagctggaacggtaa

DBGET integrated database retrieval system