KEGG   Spirochaeta africana: Spiaf_0451Help
Entry
Spiaf_0451        CDS       T01811                                 

Definition
(GenBank) membrane carboxypeptidase/penicillin-binding protein PbpC
  KO
K05367  penicillin-binding protein 1C [EC:2.4.1.129]
Organism
sfc  Spirochaeta africana
Pathway
sfc00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Spiaf_0451
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sfc01003]
    Spiaf_0451
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sfc01011]
    Spiaf_0451
Enzymes [BR:sfc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Spiaf_0451
Glycosyltransferases [BR:sfc01003]
 Polysaccharide
  Bacterial polysaccharide
   Spiaf_0451
Peptidoglycan biosynthesis and degradation proteins [BR:sfc01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Spiaf_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase BiPBP_C
Motif
Other DBs
NCBI-ProteinID: AFG36554
UniProt: H9UGB1
Position
539718..541994
Genome map
AA seq 758 aa AA seqDB search
MLLAGSCFGVVLLSVWLLLRFTPFPELQQFLQRPFSTLLVDRYGEPLRYLHPADGTRRIR
TELQDLPAWVPAAVIAAEDRRFMLHYGIDGAAVLRAASQNIRGGGRVSGASTISMQLARL
AAPHRGGLRGKAAEAWNAMRLEARYSKHELLQMYLNALPFGSGVEGIESASRRFFGVSAA
GLSPEEAVLLAVIPRRPASLNPHSFPERAVRTALPSAAAAGVNADEQMLLAAIQAGQARA
AGYHEPFEAPHLADRISRELTPAQRAAGGSLRTTLDLELQHRLEDLLYARLRAAGDSRIH
NGAALVLDHHRGEVLAYVGSHDYFDDQNSGMIDAVRIRRQPGSTLKPFLYALALEAGFTA
ATILPDTPQAFGAEEAYIPQNFSRRFAGPVRLRTALSSSLNIPAVHTVVRLGVGAFADHL
EDLGFSSVADQRDRVGAGIALGNVEVSLLELATAFSVFAGDGNLPEYRVLLPTDHTSGPA
LNQPAYPAHGISHPHYDAATVQIIRDILADQADRVLGFGADSVLNTSFPSIAKTGTANQF
SNIWALAADPDYTVGVWMGNIHGETVIGRPGSSLPATVAMQLLQDIHETGRRFPPADAVH
QVRISPISGMRYDPPGGGSIPELFPHGEYPPEDTWHSYPGGPIRYPPEYQDWVRDMGFRS
AGGAADGRAATRVRIQSPNDGARFYRDPYISERHQSIGVVVTSDGQEPIQLYWNDSLAAE
GHSPLRWQLPVIPGRHRITAVAGSVQDQIRLQVGASEP
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttgccggcagctgtttcggggtggtgctgttgtcggtctggctgctgctgcga
tttaccccttttccggagctgcagcagtttttacagcggcccttcagtactctgctggtg
gatcgctatggcgagccgctgcgctatctgcaccccgctgacggcacacgccgaatccgg
accgagctgcaggatctgccggcctgggtgccggcggcggtaatcgcagccgaggaccgc
cgatttatgctgcattacgggatcgatggcgccgcggttttgcgtgcggccagccagaat
atccgcggcggcggacgggtctcgggtgccagtaccatcagcatgcagctggctcgcctg
gctgccccgcaccgcggcgggctgcgcggcaaggccgccgaggcctggaatgcgatgcgg
ctggaagcccgctacagcaagcatgagctgctgcagatgtacctgaatgcgctgcccttc
ggcagcggggttgaaggtatagagagtgcatcccggcggttcttcggggtatccgctgcc
gggctttcaccagaagaggcggtactgctggcggtcataccgcgccggcccgcctccctg
aatccacattcctttccggagcgggcggtgcgcactgccctgccatcggctgccgctgct
ggcgtgaatgccgatgagcagatgctgctggcagccatccaggccgggcaggcacgggct
gcagggtatcatgaaccattcgaggcacctcatctggccgaccggatctcccgtgagctt
acccccgcacagcgggctgccggcggcagcctgcgtaccaccctggatcttgagctgcag
caccggctggaggatctgctgtatgcccgcttgcgggctgccggggatagccgcatccac
aacggcgcggccctggtgctggaccaccaccggggcgaggtgctggcctatgtcggcagt
cacgattactttgacgatcagaacagcggaatgatcgatgcggtccgcatccgtcgtcag
cccggctccaccctgaaaccattcctgtacgccctggcgctggaggccggctttaccgcc
gcgacaatcctgccggataccccgcaggcattcggggccgaggaggcctatatcccgcaa
aacttctcgcgccgctttgccggcccggtacggttgcggacggcattgtcctccagcctg
aacatcccggcggtgcacacggtggtgcggctgggggtaggcgcctttgcggatcatctg
gaagacctcgggttttcgagcgttgccgatcagcgcgatcgggttggtgccgggattgcc
ctggggaatgtcgaggtctcgctgctggagctggcaaccgcgttttcggtgtttgctggc
gacggaaacctgccggaatatcgggtgctgctgcccactgatcacacttcgggcccggcg
ctgaatcagcccgcttatccggcccacgggatttctcacccgcactatgatgcggcaacg
gtgcagataatccgggatatccttgctgatcaggccgatcgggtgctgggatttggtgcc
gactcggtgctgaacaccagttttccgtcgatcgctaaaaccggtaccgccaatcagttt
tccaatatctgggcacttgcagccgacccggactataccgtgggtgtctggatgggaaac
atccatggggagaccgttatcgggcgtccaggcagctcgctgccggcaacggtagcaatg
cagctgctgcaggacattcatgaaaccggccgccgctttccccccgcagatgcggtgcac
caggtaaggatctcaccgatctccggtatgcgctacgatcccccgggcggtggcagtatc
ccggaactgttcccgcatggcgaatatcccccggaggatacctggcacagctaccccggc
ggcccgatccgctacccgccggaatatcaggactgggtgcgggacatgggattcagatcc
gccgggggtgctgctgatggccgggcagcgacccgggtgcgtatccagtcacccaacgac
ggggcccggttctaccgggacccgtacatcagtgaacgtcatcagagcatcggtgtagtg
gtgacaagcgacggccaggagccgatccagctgtactggaacgacagcctggctgccgag
ggccattccccacttcggtggcagctgccggtgatacctgggcgtcaccggattacggct
gtcgccggcagcgtgcaggaccagatccggctccaggtgggtgcgagcgagccctga

DBGET integrated database retrieval system