KEGG   Spirochaeta africana: Spiaf_0466Help
Entry
Spiaf_0466        CDS       T01811                                 

Definition
(GenBank) galactose mutarotase-like enzyme
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sfc  Spirochaeta africana
Pathway
sfc00010  Glycolysis / Gluconeogenesis
sfc00052  Galactose metabolism
sfc01100  Metabolic pathways
sfc01110  Biosynthesis of secondary metabolites
sfc01120  Microbial metabolism in diverse environments
sfc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spiaf_0466
   00052 Galactose metabolism
    Spiaf_0466
Enzymes [BR:sfc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Spiaf_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFG36569
UniProt: H9UGC6
Position
556659..557690
Genome map
AA seq 343 aa AA seqDB search
MEITKDRFGSAFDGTPVDIITISNSSGITLQCMSYGATLVSLKMPGRDGKLSDLVLGFDS
FDDYLKPHPYLGATIGRVAGRISKAQFSIGPRTFTLERNDGSNHLHGGRNGFDKVIWTPR
IFGDGDEVGVTFSRTSPDGEEGYPGKLDVEVTYALNDRNELAIRYRAESSKATPVNLTNH
TYWNLGGNGSILNHKLRINSKKYLPVDDNTIPMGDILETDGTPMDFSSAHPIGRDIKLVP
GGYDHCYVLPEAETRLRPAAILNHPESGRTMEVYTTKPGLQLYTANKLRDVVGKHGIHYG
KHSGVCLETMYFPDSVNQHDFPGIILRPKEEYHHETVHRFSIR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaaataacaaaagacagattcggttccgcgttcgatggaaccccggtagatatcatt
accatctccaacagcagcgggattaccctgcagtgtatgtcctacggggctaccctggtg
tccctcaagatgcccggccgcgacggcaaactgagcgatctggtacttggcttcgacagt
ttcgatgactatctcaagccccacccgtatctcggggccaccatcgggcgggtcgccggg
cgcatcagcaaggcgcagttctccatcggcccgcgcacctttaccctggagcgtaacgac
ggcagcaaccatctgcatggcggccgcaacgggtttgacaaggtaatctggacaccccgg
atctttggcgacggcgacgaggtaggcgtgaccttctcgcgcaccagtcccgacggcgag
gaggggtaccccggcaagctcgatgtagaggtaacctacgccctgaacgaccgcaacgag
ctggctatccgctaccgtgccgaatcctccaaagcgaccccggtcaaccttaccaaccac
acctactggaatctgggcggcaacggctccatcctcaatcacaagctgcgcattaactcc
aaaaaatacctgccggtagatgacaacaccatcccgatgggcgacatcctggaaaccgac
ggcacccccatggatttttccagcgcccacccgatcggccgtgatatcaagctggttccc
ggcggctacgaccactgctatgtcctgcccgaagccgaaacccgactgcgcccggcagcc
atcctgaaccaccccgagtccggccgcaccatggaggtctacaccaccaagcccgggctg
cagctgtacaccgccaacaagctgcgggatgtggtcggcaaacacggcatccactacggc
aaacactccggcgtctgcctggagaccatgtactttcccgactcggtaaatcagcacgac
tttcccgggattatcctgcgccccaaggaagagtaccaccacgaaacggtacaccgcttc
tcgatccggtag

DBGET integrated database retrieval system