KEGG   Spirochaeta africana: Spiaf_2547Help
Entry
Spiaf_2547        CDS       T01811                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sfc  Spirochaeta africana
Pathway
sfc00260  Glycine, serine and threonine metabolism
sfc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sfc01100  Metabolic pathways
sfc01110  Biosynthesis of secondary metabolites
sfc01130  Biosynthesis of antibiotics
sfc01230  Biosynthesis of amino acids
Module
sfc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spiaf_2547
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spiaf_2547
Enzymes [BR:sfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spiaf_2547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: AFG38577
UniProt: H9UM34
Position
complement(2898673..2899416)
Genome map
AA seq 247 aa AA seqDB search
MSKQLQVMAHMIPYYPDQETAEAAVAGLVAGGATHIEVQFPFSDPTADGPTIQAACSRAL
GQGFRVDEGFRFVRRAAAAHDVPVFIMSYASLVYARGVERFVQDARAAGVTGLIVPDLPV
DADEGLYAAAGAAGLEVWPVVVPNTPPERIALIQEVKPRGVYAALRAGITGSRTEIGQDN
LRFLDQLHDLGAPVFAGFGIRERDQVQALAPHVAGVVIGSAFVEIIADSTPQNVASRLEE
FLRSLLR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcagttgcaggtaatggcccatatgatcccgtattacccggatcaggagaca
gctgaggcagcggttgccgggctggtcgccggcggggctactcacattgaggtgcagttt
cccttttcggatcccacggctgatggaccgaccatccaggctgcctgctcgcgcgccctg
gggcaggggtttcgggtcgatgaagggttccggtttgtgcgtcgggcggctgcggcccac
gatgtgccggtgtttatcatgagttacgcatcgctggtgtatgcgaggggggttgagcga
tttgtgcaggatgcacgggcagccggggtaaccggcctgattgtgccggacttgccggtc
gatgccgacgaaggattgtatgcggccgccggcgcagccggcctggaggtgtggccggta
gtcgtgccgaacacaccgccggagcggattgccctgatacaagaggtaaagccgcgcggg
gtttacgcggctctgcgggccgggatcaccggatcccgcaccgagatcgggcaggacaat
ctccgttttctggatcagctgcatgacctcggtgccccggtgtttgccggcttcggcatc
cgggagcgggatcaggtgcaggccctggccccccatgttgccggggtggtgataggctcg
gcatttgtcgagatcattgcagacagcaccccgcagaatgtagccagcaggcttgaggag
tttctgcggagcctgctgcgctga

DBGET integrated database retrieval system