KEGG   Spirochaeta africana: Spiaf_2763Help
Entry
Spiaf_2763        CDS       T01811                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sfc  Spirochaeta africana
Pathway
sfc00260  Glycine, serine and threonine metabolism
sfc00750  Vitamin B6 metabolism
sfc01100  Metabolic pathways
sfc01110  Biosynthesis of secondary metabolites
sfc01120  Microbial metabolism in diverse environments
sfc01230  Biosynthesis of amino acids
Module
sfc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spiaf_2763
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Spiaf_2763
Enzymes [BR:sfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Spiaf_2763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFG38787
UniProt: H9UMP4
Position
complement(3165274..3166578)
Genome map
AA seq 434 aa AA seqDB search
MQLKSTNNQAPIVGFPEALFQGLAPDGGLYVPVEEADLKQRLRSLGPADDFPAVAATVVE
GLLGDTLGDPLEFARSTFPFAPELRDLGNGIYVLELWHGPSAAFKDYGAAFLAASMERLL
TDRNQRAIILTATSGDTGSAVAQAFHNRENIDVVILYPEGRVSPLQEKQLTTLGGNIHAL
RVQGAFDDCQRMVKEAFMDRDLCAKVPLTSANSINIGRLIPQSFYYVWAHAQLKDANAGE
RMFVVPSGNFGNLTAGVMAWRWGLPIDAFLAATNANDVVPEYLETGIYTPRESVATYSNA
MDVGRPSNFDRLMHIFGNSLESVRSMIGGEVVNDTETLALMQRYHRSKGVFLDPHTAVGV
AAAERRIKDYTGGRIIVLGTAHPGKFLEVVEQATGVQPPLPDRLQSVLAKQGQSEPIAAE
AAALRARLIEWFHA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgaaaagcaccaataaccaggcaccgattgtgggtttccccgaggctctgttt
caggggctggcaccggacggggggttgtatgtccctgtcgaggaggcggacctgaaacag
cgattgcggtctctaggaccggctgatgacttcccggcggtcgcggctacggtggtagag
gggctcctgggcgacacccttggcgatccgctggagttcgcccgcagtacctttcccttt
gctcctgagctgcgtgacctgggtaacggtatctacgttctcgaactttggcacgggcca
tcggcggcgttcaaggactacggggcggctttcctggccgcttcgatggaacgactgctt
accgatcgcaaccagcgggcaattattctgaccgcaaccagcggtgataccggaagtgcg
gtagcccaggcctttcataatcgcgagaatatcgatgtggttatcctgtatcccgaggga
cgcgtaagtccgctgcaggaaaaacagttgaccacccttggcggaaatatccatgccctc
cgggtgcagggggcgttcgatgactgccagcgcatggtcaaagaggcctttatggatcgt
gacctgtgcgccaaggttccgttgaccagtgcaaactctattaacatcggtcgactcatt
ccccaatccttctactatgtgtgggcccatgcccagctcaaggatgccaatgccggagag
cggatgtttgtggttcccagcgggaatttcggtaacctgacagcaggtgtaatggcctgg
cgatggggtttgccgattgatgcatttcttgccgctacgaatgccaacgatgttgtgccg
gaatatcttgagactggcatctacactccccgcgagtcggtggcaacctactccaacgcg
atggatgttggccgaccgagcaatttcgatcggctgatgcacatcttcggtaattcgctg
gagagcgtgcgcagcatgattgggggcgaggtggtgaatgacaccgaaacactggcactg
atgcagcggtatcaccgctccaagggggtttttctggatccccataccgcagtcggggtg
gcagccgccgagcgccggataaaagactatactggggggcggatcatcgtgcttggcaca
gctcatccgggaaagttcctggaggtggtagagcaggcaaccggtgttcagccgccactg
ccggatcgtttgcagtcggttctcgccaagcaggggcaatcggagccgattgcagctgag
gcggcggctttgcgtgccagattgatcgagtggtttcacgcctga

DBGET integrated database retrieval system