KEGG   Sinorhizobium fredii USDA 257: USDA257_c06960Help
Entry
USDA257_c06960    CDS       T02188                                 

Definition
(GenBank) (S)-2-haloacid dehalogenase 4A
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00361  Chlorocyclohexane and chlorobenzene degradation
sfd00625  Chloroalkane and chloroalkene degradation
sfd01100  Metabolic pathways
sfd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    USDA257_c06960
   00361 Chlorocyclohexane and chlorobenzene degradation
    USDA257_c06960
Enzymes [BR:sfd01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     USDA257_c06960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6 Acid_PPase
Motif
Other DBs
NCBI-ProteinID: AFL49289
UniProt: I3X083
Position
complement(742567..743229)
Genome map
AA seq 220 aa AA seqDB search
MSHAAYVFDAYGTLFDVHAAVRRHAEAMGPDGQAFSELWRAKQLEYSWVRSLMGAYVDFW
QLTEQSLDYAFARFPSADPKLKKQLLDAYWALDCYPEVPAVLKGLKERGARIAILSNGSP
AMLASAVKNAALDIIIDDVFSVDAVKAFKTAPAVYDLVTTQYRLYPHAVSFQSSNRFDIA
GATKFGFRTVWINRADMPDEYQDYGPSLILPSLESLQFGI
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatgcggcctatgtcttcgatgcctatggcacgctgttcgatgtccatgcggcc
gtgcgccgacacgccgaggcaatgggtccagacggccaggctttctccgagctttggcgc
gccaagcaactcgaatattcctgggtgcgctcgctgatgggcgcctatgtcgatttctgg
caattgaccgagcaatctctggactatgctttcgcccgctttccctccgccgatccgaaa
ctcaagaagcaactgctcgacgcctattgggcgctcgattgctatccggaggttccggcc
gtgctcaaggggttgaaggagcgcggcgcccgtatcgccattctttcgaacggctcgccg
gccatgcttgcctcggccgtcaagaatgccgccctcgacatcatcatcgacgatgtcttc
tcggtcgatgcggtcaaggccttcaagacggcaccggccgtctacgacctggtgacgacg
caatatcggctctatccgcatgcggtttcgttccagtcgtcgaaccgcttcgacattgcc
ggcgctaccaaattcggcttccgtacggtgtggatcaaccgcgctgatatgcccgacgag
taccaggactatggcccctcgctcatcctgccttcactggaaagcctgcaattcggcata
tga

DBGET integrated database retrieval system