KEGG   Sinorhizobium fredii USDA 257: USDA257_c22790Help
Entry
USDA257_c22790    CDS       T02188                                 

Gene name
melA2
Definition
(GenBank) alpha-galactosidase MelA
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00052  Galactose metabolism
sfd00561  Glycerolipid metabolism
sfd00600  Sphingolipid metabolism
sfd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    USDA257_c22790 (melA2)
  Lipid metabolism
   00561 Glycerolipid metabolism
    USDA257_c22790 (melA2)
   00600 Sphingolipid metabolism
    USDA257_c22790 (melA2)
Enzymes [BR:sfd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     USDA257_c22790 (melA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AFL50860
UniProt: I3X4Q4
Position
2384899..2386371
Genome map
AA seq 490 aa AA seqDB search
MGSFKIAIIGAGSVGFTKKLFTDILSVPELRDVEFALTDLSEHNLGMIKTILDRIVEANN
LPTRVTATTDRRKALEGARYIISCVRVGGLEAYADDIRIPLKYGVDQCVGDTICAGGILY
GQRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQ
IAEILGAKDGEFDYVCSGINHQTWFIDVRLNGRKIGKDELIAAFEAHPVFSKQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEITKWIDMSDWIHGETGGYLRYSTETRNWFETE
YPRFLEEAGRPLDTIKRSNEHASHILEALETGRVYRGHFNVKNNGVISNLPADAIIESPG
FVDRFGINMVSGITLPEACAATCISSINVQRMSVHAAITGDIDLLKLAVLHDPLVGAICT
PEEVWQMVDEMVVAQAQWLPQYAHAVEAAKDRLARSTVKTREWTGAARREVRSIEEIRAE
KEAAKLRAAG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcttcaaaatcgccattatcggcgccggcagcgtcggtttcaccaagaagctt
ttcaccgacatcctgtccgtgccggagctccgcgacgtcgagttcgccttgacggatctg
agcgagcacaatctcggcatgatcaagacgatcctcgaccggattgtcgaggcgaataat
cttccgacacgcgtcacggcaaccacagatcgacgcaaagcgctcgaaggcgctcgctat
atcatcagctgcgtccgggtgggcggcctcgaggcctatgcggacgatatccgcattccg
ctgaaatacggggtcgaccaatgcgtcggcgacacgatctgcgccggcggcattctctac
ggccagcgcaacattccggtcatcctcgatttctgcaaggacatccgcgaggtcgccgag
cccggggccaagttcctgaactatgccaacccgatggcgatgaacacctgggcggcgatt
gaatatggaaaggtcgacactgtcggtctctgccacggcgtccagcacggcgccgagcag
atcgccgagatcctcggcgccaaggacggcgagttcgactatgtctgctccggcatcaac
caccagacctggttcatcgacgtccgcctcaacggccgcaagatcggcaaggacgagctc
attgccgccttcgaggcccatccggtcttctccaagcaggagaagctcagaatcgacgtc
ctgaagcgcttcggcgtctattcgaccgaaagcaacggccatctctctgaatacctgccc
tggtaccgcaagcgccctgacgagatcaccaaatggatcgacatgtcggactggatccat
ggcgagaccggcggctacttgcgctattcgaccgagacccgcaactggttcgagaccgag
tatccgcgcttcctcgaagaggccggcaggccgctcgatacgatcaagcgctcgaacgag
catgcgagccatatcctcgaagcgctcgagaccgggcgcgtctatcgcggtcatttcaac
gtcaagaacaatggcgtgatcagcaacctgccggcggatgcgatcatcgaatctcctggc
ttcgtggatcgcttcggcattaacatggtgtccggcattacgcttcccgaggcctgtgcc
gccacctgcatctcgtcgatcaatgtccagcgcatgtccgttcatgcggcgatcaccggg
gacatcgaccttctgaagctcgcggtgctgcacgacccgctggtcggcgcgatctgcacg
ccggaggaggtctggcagatggtcgacgaaatggtcgtcgctcaagcacaatggctgccg
caatatgcccatgccgtcgaggcggccaaggatcggctcgcccgatcgacggtgaagacc
cgcgaatggacgggcgcggcccggcgcgaggtgcgctctatcgaggaaatccgcgccgag
aaggaagccgcaaagctgcgcgctgccggctag

DBGET integrated database retrieval system