KEGG   Sinorhizobium fredii USDA 257: USDA257_c22840Help
Entry
USDA257_c22840    CDS       T02188                                 

Gene name
melA3
Definition
(GenBank) alpha-galactosidase MelA
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00052  Galactose metabolism
sfd00561  Glycerolipid metabolism
sfd00600  Sphingolipid metabolism
sfd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    USDA257_c22840 (melA3)
  Lipid metabolism
   00561 Glycerolipid metabolism
    USDA257_c22840 (melA3)
   00600 Sphingolipid metabolism
    USDA257_c22840 (melA3)
Enzymes [BR:sfd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     USDA257_c22840 (melA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-ProteinID: AFL50865
UniProt: I3X4Q9
Position
2392602..2393975
Genome map
AA seq 457 aa AA seqDB search
MTRQPKITFIGAGSTVFMKNIIGDVLQRPALSAATIALMDLNPERLAESEIVAGKLVRTL
GVQAKVETHSNQLTALEGADFVVVAFQIGGYEPCTVTDFEVPKKYGLRQTIADTLGVGGI
MRGLRTVPHLWKICEDMLQVCPEAILLQYVNPMAINTWAIAEKFPTIKQVGLCHSVQGTA
FELARDLEIPLEEIRYRAAGINHMAFYLKFEHRQNDGSYRDLYPDLIRGYREGRFPKPSH
WNPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKDGRPDLIEKFGIPLDEYPKRCIE
QIERWKGQAAAYKEAETIEVAESHEYASSIMNSVWTGEPSVIYGNLRNNGCITSLPENCA
AEVPCLVDASGIQPTYVGALPPQLTALIRTNINVQELTVQALVTENREHLYHAAMMDPHT
AAELDLDQIWSLVDDLLVAHRDWIPEWARISKKVQAA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacgagacaacccaagatcaccttcatcggcgccggctcgaccgtcttcatgaagaac
atcatcggcgacgttctgcagcggccggcgctttcggccgcgacgatcgccttgatggac
ctgaacccggagcgcctcgccgaaagcgagatcgtcgccggcaagctggtgcgcaccctt
ggcgtccaagcaaaggtcgaaacccattcgaaccagctgacggccctcgaaggcgccgat
ttcgtcgtcgtcgccttccagatcggcggctatgagccctgcaccgtcaccgatttcgag
gtgccgaagaaatacggcctgcgccagacgatcgccgacacactcggcgtcggcggcatc
atgcgcggccttcgcactgtgccgcatctctggaagatatgcgaggacatgcttcaggtc
tgcccggaggcgatcctgctgcagtacgtcaacccgatggcgatcaacacctgggcgatc
gccgaaaaattcccgacgatcaagcaggtcggcctctgccactcggtgcaggggacggcc
ttcgagcttgcccgcgaccttgaaattccgctcgaggaaattcgctaccgggccgcgggc
atcaaccacatggccttctatctgaagttcgagcatcgccagaacgacggcagctaccgc
gacctctatccggatctgatccgcggctatcgcgaagggcggttcccgaagcccagccac
tggaacccgcgctgcccgaacaaggtgcgctacgagatgctgacgcggctcggctatttc
gtcaccgagagctcggagcacttcgccgaatacacgccctatttcatcaaggacggccgt
ccggacctgatcgagaaattcggcattccgctcgacgaatatccgaagcgctgcatcgag
cagatcgagcgctggaaggggcaggcggccgcctacaaggaggccgagacgatcgaggtg
gcggagagccacgaatacgcctcgtcgatcatgaactcggtctggaccggcgagccatcg
gtgatctacggcaacctcaggaacaacggctgcatcacctcgctgccggaaaactgcgcc
gccgaagtcccctgcctcgtcgatgcctccggcatccagccgacctatgtcggcgcgctg
ccgccgcagctgaccgcgctcatccgcaccaatatcaacgtgcaagagctgacggtgcag
gcgctcgttaccgaaaaccgcgagcacctctatcacgcggcgatgatggatccgcacacg
gccgccgagctcgacctcgaccagatctggtcgctcgtcgacgacctgctcgtcgcccat
cgagactggattcccgaatgggcccgtatttcgaaaaaggtacaggccgcctga

DBGET integrated database retrieval system