KEGG   Sinorhizobium fredii USDA 257: USDA257_c23120Help
Entry
USDA257_c23120    CDS       T02188                                 

Definition
(GenBank) putative ribulose bisphosphate carboxylase-like protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00630  Glyoxylate and dicarboxylate metabolism
sfd00710  Carbon fixation in photosynthetic organisms
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01120  Microbial metabolism in diverse environments
sfd01130  Biosynthesis of antibiotics
sfd01200  Carbon metabolism
Module
sfd_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    USDA257_c23120
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    USDA257_c23120
Enzymes [BR:sfd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     USDA257_c23120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AFL50892
UniProt: I3X4T6
Position
2425497..2426753
Genome map
AA seq 418 aa AA seqDB search
MIRITYRIETPGDVVALAAKIASDQSTGTFVPVPGETEELKARVAARVVAIRNLEPTDRP
SWPEEAGEAKRFNRADADIEFPLDAVGTDLAALMTIAIGGVYSVKGMTGVRVVDMKLPPE
FCAAHPGPQFGVAGSRRLTGVEEGPIIGTIVKPALGLRPEETGELVGELLSSGVDFIKDD
EKLMSPVYSPLKERIAAIMPRILNHEQKTGKKVMYAFGISHTDPDEMMRNHDHVVQAGGN
AGVVNINSIGMGGLGFLRKRSGIVLHAHRNGWDILTRHGGLGMEFSVWQQFWRLIGVDQF
QINGIRVKYWEPDESFVKSFKAVSTPLLSERDCPLPVVGSGQWGGQAPETYARTGGSTDL
LYLCGGGIVSHPGGAGAGVRAVRHAWEAAVAGIPLADYAKDHPELAQSLVKFADGKGT
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgcatcacctaccgcatcgagaccccgggcgacgttgtggcgctggcggccaag
atcgccagcgatcagtcgaccggaacctttgtgccggtccccggcgaaaccgaggaattg
aaggcgcgcgtcgcggcccgggtcgtcgcaataagaaatctggagccgaccgaccgcccc
tcctggccggaggaggcgggcgaggcgaaacgcttcaaccgggccgacgctgatatcgaa
tttccgctcgatgcggtcggcacggatctcgccgcgctgatgacgatcgccatcggaggg
gtctattcggtcaaggggatgacgggcgttcgggtggtcgacatgaagttgccgccggaa
ttttgcgccgcccatcccgggccgcagttcggcgtcgccgggagccgccggctgaccggt
gtcgaagagggcccgatcattggcacaatcgtcaagcccgccttgggcttgaggccggag
gagacgggtgaactggtgggtgaactgctctcctccggcgtcgatttcatcaaggacgac
gagaagctgatgagcccggtctattcgccgctgaaggagcgcatcgccgcgatcatgccg
aggatcctcaaccacgagcagaagaccggcaagaaggtgatgtatgccttcggcatctcc
catacggaccccgacgagatgatgcgcaaccacgatcacgtcgttcaggcgggtggcaat
gcgggggtcgtcaacatcaattcgatcggaatggggggtcttggcttcctacgcaagcgc
tcggggatcgtgctccacgcgcaccgaaacggctgggatatcctgacccgccacggcggt
ctcggaatggaattctccgtctggcagcagttctggcggctgatcggcgtggaccagttc
cagatcaacggcatccgcgtcaaatattgggaaccggacgagagcttcgtgaaatccttc
aaggcggtcagcacgccgctcctttccgaacgcgattgtccgctgcctgtggtcggctcc
ggccaatggggcgggcaggcgcccgagacctatgcccgcaccggcggctcgaccgatctg
ctttatctctgcggcggcggcatcgtcagccatccgggcggcgctggcgccggggtcagg
gcggttcgtcatgcctgggaggcggcggtcgccggtattccgcttgccgattatgccaag
gatcatccggaactcgcccagtccctggtgaaattcgccgacggcaagggcacctga

DBGET integrated database retrieval system