KEGG   Sinorhizobium fredii USDA 257: USDA257_c24110Help
Entry
USDA257_c24110    CDS       T02188                                 

Definition
(GenBank) hypothetical protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sfd  Sinorhizobium fredii USDA 257
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    USDA257_c24110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Fzo_mitofusin
Motif
Other DBs
NCBI-ProteinID: AFL50987
UniProt: I3X531
Position
2527476..2527763
Genome map
AA seq 95 aa AA seqDB search
MSSATILSLVAQFAMPVSPTHSISTAIMGAGFAKCPHALRWTVIEHILWAWILTIPAAGG
AAYGLLRLFEAFSWTSLSRGEVAKFGRHDCILTNF
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggcgacaattctttcgctcgtcgcgcagttcgccatgcccgtatcgcccacg
cacagcatctcgaccgccatcatgggtgcgggctttgccaagtgcccgcacgcgttgagg
tggacggtgattgagcacatcctttgggcgtggatactgacgatcccggccgcaggcggt
gcggcctacggtttgctcaggttgtttgaggcgttcagctggactagcctctcacgaggt
gaagtcgctaaattcgggcggcacgactgcattctcaccaatttctaa

DBGET integrated database retrieval system