KEGG   Sinorhizobium fredii USDA 257: USDA257_c25440Help
Entry
USDA257_c25440    CDS       T02188                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00053  Ascorbate and aldarate metabolism
sfd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    USDA257_c25440
Enzymes [BR:sfd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     USDA257_c25440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 RmlD_sub_bind Polysacc_synt_2 NmrA NAD_binding_4 PS_pyruv_trans adh_short PAS_12
Motif
Other DBs
NCBI-ProteinID: AFL51119
UniProt: I3X5G3
Position
complement(2665224..2666036)
Genome map
AA seq 270 aa AA seqDB search
MSDYQRVLLTGAAGALGTELRKSGTRLGKNVRLSARTPCKNLAPHEEDFPLDLSDFDAVS
NAVKDCDAIIHMGGQAVEAPWQTILDSNIAGGYNVYEAARRHGVKRIVYASSVHAIGYYE
RTQTIDGNVPTRPDSLYGVSKTFVENLARYYFDKFGIETVCLRIGSSFPEPTDRRHLITW
LSYRDCRQLVEKSLSAPRVGFMIAYGMSNNSEAFWNNRTAAVLGYKPQDSADDYREKVFA
KTTQGDPNDPAVRFQGGSFCAMGHFEDENK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtccgattatcaaagagtgttgcttaccggtgctgctggcgccctcgggaccgagctt
cgcaagtccggaaccaggctcggaaagaacgtcaggctctccgcccggacgccttgcaaa
aatctcgccccccatgaagaggacttcccgctcgacctgtctgacttcgacgcggtctcc
aacgccgtgaaggattgcgatgccatcatccatatgggcggtcaggctgtcgaagcgccg
tggcagaccatcctcgattccaatatcgctggcggctacaacgtctatgaggcggcccgc
cgccatggggtcaagcgcatcgtctatgcgagttccgtccacgcgatcggctactacgag
cggacgcagacgatcgacggcaacgtgccgacccggcccgacagcctctacggcgtgtcg
aagacctttgtcgaaaacctcgcgcgctattacttcgacaaattcggcatcgagacggtc
tgcctacgcatcggctcgtcattcccggagccgaccgatcgtcgtcacctgatcacctgg
ctctcctatcgcgactgccgccaactggtcgaaaagtcactgtcggctccgcgggtcggc
ttcatgatcgcctatggcatgtccaacaattcagaggccttctggaacaaccgcaccgcc
gccgtgctcggctacaagccgcaggacagcgccgacgactatcgggaaaaggtcttcgcc
aagacgacgcagggcgacccgaatgacccggccgtgcgctttcagggcgggagcttctgt
gccatgggccacttcgaagacgagaacaagtaa

DBGET integrated database retrieval system